Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Butyrophilin 3A3/BTN3A3 (C-6His)

Source: Human Cells. MW :24.6kD. Recombinant Human Butyrophilin 3A3 is produced by our Mammalian expression system and the target gene encoding Gln30-Trp248 is expressed with a 6His tag at the C-terminus. Human BTN3A3, also known as butyrophilin subfamily 3 member A3 and BTF3, is a Single-pass type I membrane protein which belongs to the immunoglobulin superfamily and BTN/MOG family. The butyrophilin (BTN) genes are a group of major histocompatibility complex (MHC) -associated genes that encode type I membrane proteins with 2 extracellular immunoglobulin domains and an intracellular B30.2 (PRYSPRY) domain. It can be detected in peripheral blood mononuclear cells, T-cells l, spleen and lymphocytes. BTN3A3 plays a role in T-cell responses in the adaptive immune response.

Product Specifications

Gene Name

BTN3A3

Gene ID

10384

UniProt

O00478

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

QFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELRWVSSSLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVELKVAALGSDLHIEVKGYEDGGIHLECRSTGWYPQPQIKWSDTKGENIPAVEAPVVADGVGLYAVAASVIMRGSSGGGVSCIIRNSLLGLEKTASISIADPFFRSAQPWVDHHHHHH
More Discoveries

Explore Other Products

Browse additional items from our catalog

TIF1 gamma (TRIM33) Mouse Monoclonal Antibody [Clone ID: OTI9D4]
TA500119 100 µL

TIF1 gamma (TRIM33) Mouse Monoclonal Antibody [Clone ID: OTI9D4]

Sign In for Pricing
View Details
FosB Antibody
RQ6482 100 µg

FosB Antibody

Sign In for Pricing
View Details
MIR6951 Mouse MicroRNA Expression Plasmid (MI0022798)
SC402832 10 µg

MIR6951 Mouse MicroRNA Expression Plasmid (MI0022798)

Sign In for Pricing
View Details
Mouse anti-Human Myeloperoxidase, Purified mAb
MBS8510533-01 100 Tests

Mouse anti-Human Myeloperoxidase, Purified mAb

Sign In for Pricing
View Details
Mouse anti-Human Myeloperoxidase, Purified mAb
MBS8510533-02 500 Tests

Mouse anti-Human Myeloperoxidase, Purified mAb

Sign In for Pricing
View Details
Mouse anti-Human Myeloperoxidase, Purified mAb
MBS8510533-03 0.1 mL (AF750)

Mouse anti-Human Myeloperoxidase, Purified mAb

Sign In for Pricing
View Details