Recombinant Human Butyrophilin 3A3/BTN3A3 (C-6His)

Source: Human Cells. MW :24.6kD. Recombinant Human Butyrophilin 3A3 is produced by our Mammalian expression system and the target gene encoding Gln30-Trp248 is expressed with a 6His tag at the C-terminus. Human BTN3A3, also known as butyrophilin subfamily 3 member A3 and BTF3, is a Single-pass type I membrane protein which belongs to the immunoglobulin superfamily and BTN/MOG family. The butyrophilin (BTN) genes are a group of major histocompatibility complex (MHC) -associated genes that encode type I membrane proteins with 2 extracellular immunoglobulin domains and an intracellular B30.2 (PRYSPRY) domain. It can be detected in peripheral blood mononuclear cells, T-cells l, spleen and lymphocytes. BTN3A3 plays a role in T-cell responses in the adaptive immune response.

Product Specifications

Gene Name

BTN3A3

Gene ID

10384

UniProt

O00478

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

QFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELRWVSSSLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVELKVAALGSDLHIEVKGYEDGGIHLECRSTGWYPQPQIKWSDTKGENIPAVEAPVVADGVGLYAVAASVIMRGSSGGGVSCIIRNSLLGLEKTASISIADPFFRSAQPWVDHHHHHH