Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Ketohexokinase/KHK (C-6His)

Source: Human Cells. MW :33.7kD. Recombinant Human Ketohexokinase is produced by our Mammalian expression system and the target gene encoding Met1-Val298 is expressed with a 6His tag at the C-terminus. Ketohexokinase, also known as Hepatic fructokinase, is a member of the carbohydrate kinase PfkB family. It exits as a homodimer and most abundant in liver, kidney, gut, spleen and pancreas. Low levels also found in adrenal, muscle, brain and eye.This enzyme catalyzes conversion of fructose to fructose-1-phosphate. It is the first enzyme with a specialized pathway that catabolizes dietary fructose. Defects in KHK are the cause of fructosuria.

Product Specifications

Gene Name

KHK

Gene ID

3795

UniProt

P50053

Components

Supplied as a 0.2 μm filtered solution of 20mM TrisHCl,50nM KCl,10%Glycerol, pH7.4.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MEEKQILCVGLVVLDVISLVDKYPKEDSEIRCLSQRWQRGGNASNSCTILSLLGAPCAFMGSMAPGHVADFVLDDLRRYSVDLRYTVFQTTGSVPIATVIINEASGSRTILYYDRSLPDVSATDFEKVDLTQFKWIHIEGRNASEQVKMLQRIDAHNTRQPPEQKIRVSVEVEKPREELFQLFGYGDVVFVSKDVAKHLGFQSAEEALRGLYGRVRKGAVLVCAWAEEGADALGPDGKLLHSDAFPPPRVVDTLGAGDTFNASVIFSLSQGRSVQEALRFGCQVAGKKCGLQGFDGIVVDHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Duox2 Mouse shRNA Lentiviral Particle (Locus ID 214593)
TL519794V 500 µL Each

Duox2 Mouse shRNA Lentiviral Particle (Locus ID 214593)

Ask
View Details
MLPH, CT (MLPH, SLAC2A, Melanophilin, Exophilin-3, Slp homolog lacking C2 domains a, Synaptotagmin-like protein 2a)
MBS648364-01 0.2 mL

MLPH, CT (MLPH, SLAC2A, Melanophilin, Exophilin-3, Slp homolog lacking C2 domains a, Synaptotagmin-like protein 2a)

Ask
View Details
MLPH, CT (MLPH, SLAC2A, Melanophilin, Exophilin-3, Slp homolog lacking C2 domains a, Synaptotagmin-like protein 2a)
MBS648364-02 5x 0.2 mL

MLPH, CT (MLPH, SLAC2A, Melanophilin, Exophilin-3, Slp homolog lacking C2 domains a, Synaptotagmin-like protein 2a)

Ask
View Details
Rat anti-cardiolipin antibody IgG (ACA-IgG) ELISA Kit
QY-E11250 96 Tests

Rat anti-cardiolipin antibody IgG (ACA-IgG) ELISA Kit

Ask
View Details
AGAP8 (AGAP4) (NM_133446) Human Tagged ORF Clone
RG213252 10 µg

AGAP8 (AGAP4) (NM_133446) Human Tagged ORF Clone

Ask
View Details