Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Ketohexokinase/KHK (C-6His)

Source: Human Cells. MW :33.7kD. Recombinant Human Ketohexokinase is produced by our Mammalian expression system and the target gene encoding Met1-Val298 is expressed with a 6His tag at the C-terminus. Ketohexokinase, also known as Hepatic fructokinase, is a member of the carbohydrate kinase PfkB family. It exits as a homodimer and most abundant in liver, kidney, gut, spleen and pancreas. Low levels also found in adrenal, muscle, brain and eye.This enzyme catalyzes conversion of fructose to fructose-1-phosphate. It is the first enzyme with a specialized pathway that catabolizes dietary fructose. Defects in KHK are the cause of fructosuria.

Product Specifications

Gene Name

KHK

Gene ID

3795

UniProt

P50053

Components

Supplied as a 0.2 μm filtered solution of 20mM TrisHCl,50nM KCl,10%Glycerol, pH7.4.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MEEKQILCVGLVVLDVISLVDKYPKEDSEIRCLSQRWQRGGNASNSCTILSLLGAPCAFMGSMAPGHVADFVLDDLRRYSVDLRYTVFQTTGSVPIATVIINEASGSRTILYYDRSLPDVSATDFEKVDLTQFKWIHIEGRNASEQVKMLQRIDAHNTRQPPEQKIRVSVEVEKPREELFQLFGYGDVVFVSKDVAKHLGFQSAEEALRGLYGRVRKGAVLVCAWAEEGADALGPDGKLLHSDAFPPPRVVDTLGAGDTFNASVIFSLSQGRSVQEALRFGCQVAGKKCGLQGFDGIVVDHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Chicken Calcyphosin-like protein (CAPSL) ELISA Kit
MBS7203236-01 48 Well

Chicken Calcyphosin-like protein (CAPSL) ELISA Kit

Ask
View Details
Chicken Calcyphosin-like protein (CAPSL) ELISA Kit
MBS7203236-02 96 Well

Chicken Calcyphosin-like protein (CAPSL) ELISA Kit

Ask
View Details
Chicken Calcyphosin-like protein (CAPSL) ELISA Kit
MBS7203236-03 5x 96 Well

Chicken Calcyphosin-like protein (CAPSL) ELISA Kit

Ask
View Details
Chicken Calcyphosin-like protein (CAPSL) ELISA Kit
MBS7203236-04 10x 96 Well

Chicken Calcyphosin-like protein (CAPSL) ELISA Kit

Ask
View Details
Anti-ACLY antibody
STJ111942 100 µl

Anti-ACLY antibody

Ask
View Details
TMEM131 CRISPRa sgRNA lentivector (set of three targets)(Mouse)
46886124 3x 1.0µg DNA

TMEM131 CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Ask
View Details