Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human ADAM-like Protein Decysin-1/ADAMDEC1 (C-6His)

Source: Human Cells. MW :50.4kD. Recombinant Human ADAM-like protein decysin-1 is produced by our Mammalian expression system and the target gene encoding Ile31-Glu470 is expressed with a 6His tag at the C-terminus. ADAM DEC1 protein is expressed highly in the small intestine and appendix, moderately in lymph node, mucosal lining of the colon, thymus, spleen and very weakly in the bone marrow. ADAM DEC1 is induced during DC maturation and up-regulated in response to T-cell signals. It may play an important role in the control of the immune response and during pregnancy.

Product Specifications

Gene Name

ADAMDEC1

Gene ID

27299

UniProt

O15204

Components

Supplied as a 0.2 μm filtered solution of 20mM TrisHCl,150mM NaCl,1mM ZnCl2, pH7.5.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

IAIKQTPELTLHEIVCPKKLHILHKREIKNNQTEKHGKEERYEPEVQYQMILNGEEIILSLQKTKHLLGPDYTETLYSPRGEEITTKPENMEHCYYKGNILNEKNSVASISTCDGLRGYFTHHHQRYQIKPLKSTDEKEHAVFTSNQEEQDPANHTCGVKSTDGKQGPIRISRSLKSPEKEDFLRAQKYIDLYLVLDNAFYKNYNENLTLIRSFVFDVMNLLNVIYNTIDVQVALVGMEIWSDGDKIKVVPSASTTFDNFLRWHSSNLGKKIHDHAQLLSGISFNNRRVGLAASNSLCSPSSVAVIEAKKKNNVALVGVMSHELGHVLGMPDVPFNTKCPSGSCVMNQYLSSKFPKDFSTSCRAHFERYLLSQKPKCLLQAPIPTNIMTTPVCGNHLLEVGEDCDCGSPKECTNLCCEALTCKLKPGTDCGGDAPNHTTEVDHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Recombinant Xanthomonas axonopodis pv. citri Ribonuclease H (rnhA)
MBS1341703-01 0.02 mg (E-Coli)

Recombinant Xanthomonas axonopodis pv. citri Ribonuclease H (rnhA)

Ask
View Details
Recombinant Xanthomonas axonopodis pv. citri Ribonuclease H (rnhA)
MBS1341703-02 0.1 mg (E-Coli)

Recombinant Xanthomonas axonopodis pv. citri Ribonuclease H (rnhA)

Ask
View Details
Recombinant Xanthomonas axonopodis pv. citri Ribonuclease H (rnhA)
MBS1341703-03 0.02 mg (Yeast)

Recombinant Xanthomonas axonopodis pv. citri Ribonuclease H (rnhA)

Ask
View Details
Recombinant Xanthomonas axonopodis pv. citri Ribonuclease H (rnhA)
MBS1341703-04 0.1 mg (Yeast)

Recombinant Xanthomonas axonopodis pv. citri Ribonuclease H (rnhA)

Ask
View Details
Recombinant Xanthomonas axonopodis pv. citri Ribonuclease H (rnhA)
MBS1341703-05 0.02 mg (Baculovirus)

Recombinant Xanthomonas axonopodis pv. citri Ribonuclease H (rnhA)

Ask
View Details
Recombinant Xanthomonas axonopodis pv. citri Ribonuclease H (rnhA)
MBS1341703-06 0.02 mg (Mammalian-Cell)

Recombinant Xanthomonas axonopodis pv. citri Ribonuclease H (rnhA)

Ask
View Details