Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interleukin-21/IL-21

Source: E. coli. MW :15.6kD. Recombinant Human Interleukin-21 is produced by our E.coli expression system and the target gene encoding Gln23-Ser155 is expressed. IL-21 induces the production of IgG1 and IgG3 in B-cells. IL-21 may promote the transition between innate and adaptive immunity. IL-21 may have a role in proliferation and maturation of natural killer cells in synergy with IL15. IL-21 stimulates interferon gamma production in T-cells and natural killer cells by synergy with IL15 and IL18. Dysregulation of IL-21 has a role in multiple immune-mediated diseases including lupus, psoriasis and chronic inflammatory diseases.

Product Specifications

Gene Name

IL21

Gene ID

59067

UniProt

Q9HBE4

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.2.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test. Biological Activity : Measured by its ability to binding recombinant human IL2RG used funtional ELISA.

Amino Acids

MQGQDRHMIRMRQLIDIVDQLKNYVNDLVPEFLPAPEDVETNCEWSAFSCFQKAQLKSANTGNNERIINVSIKKLKRKPPSTNAGRRQKHRLTCPSCDSYEKKPPKEFLERFKSLLQKMIHQHLSSRTHGSEDS

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

pCMV-SPORT6.ccdb-Ddit4-r Plasmid
PVT22239 2 µg

pCMV-SPORT6.ccdb-Ddit4-r Plasmid

Ask
View Details
MFSD11 (NM_024311) Human Tagged ORF Clone
RG201197 10 µg

MFSD11 (NM_024311) Human Tagged ORF Clone

Ask
View Details
Recombinant Xenopus laevis Ribonuclease kappa-B (rnasek-b), partial
MBS7082870 Inquire

Recombinant Xenopus laevis Ribonuclease kappa-B (rnasek-b), partial

Ask
View Details
Nori® Monkey HSP70 ELISA Kit
GR169322 96 Well

Nori® Monkey HSP70 ELISA Kit

Ask
View Details
TBP2 (Thioredoxin Binding Protein 2) Mouse ELISA Kit
H4873 96 Tests

TBP2 (Thioredoxin Binding Protein 2) Mouse ELISA Kit

Ask
View Details
Goat Polyclonal HIV-1 gp120 Antibody [DyLight 405]
NBP2-41090V 0.1 mL

Goat Polyclonal HIV-1 gp120 Antibody [DyLight 405]

Ask
View Details