Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interleukin-21/IL-21

Source: E. coli. MW :15.6kD. Recombinant Human Interleukin-21 is produced by our E.coli expression system and the target gene encoding Gln23-Ser155 is expressed. IL-21 induces the production of IgG1 and IgG3 in B-cells. IL-21 may promote the transition between innate and adaptive immunity. IL-21 may have a role in proliferation and maturation of natural killer cells in synergy with IL15. IL-21 stimulates interferon gamma production in T-cells and natural killer cells by synergy with IL15 and IL18. Dysregulation of IL-21 has a role in multiple immune-mediated diseases including lupus, psoriasis and chronic inflammatory diseases.

Product Specifications

Gene Name

IL21

Gene ID

59067

UniProt

Q9HBE4

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.2.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test. Biological Activity : Measured by its ability to binding recombinant human IL2RG used funtional ELISA.

Amino Acids

MQGQDRHMIRMRQLIDIVDQLKNYVNDLVPEFLPAPEDVETNCEWSAFSCFQKAQLKSANTGNNERIINVSIKKLKRKPPSTNAGRRQKHRLTCPSCDSYEKKPPKEFLERFKSLLQKMIHQHLSSRTHGSEDS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Antibody to DHX58
MBS8528494-01 0.1 mL

Mouse Monoclonal Antibody to DHX58

Sign In for Pricing
View Details
Mouse Monoclonal Antibody to DHX58
MBS8528494-02 0.1 mL (AF405L)

Mouse Monoclonal Antibody to DHX58

Sign In for Pricing
View Details
Mouse Monoclonal Antibody to DHX58
MBS8528494-03 0.1 mL (AF405S)

Mouse Monoclonal Antibody to DHX58

Sign In for Pricing
View Details
Mouse Monoclonal Antibody to DHX58
MBS8528494-04 0.1 mL (AF610)

Mouse Monoclonal Antibody to DHX58

Sign In for Pricing
View Details
Mouse Monoclonal Antibody to DHX58
MBS8528494-05 0.1 mL (AF635)

Mouse Monoclonal Antibody to DHX58

Sign In for Pricing
View Details
Mouse Monoclonal Antibody to DHX58
MBS8528494-06 0.1 mL (APC)

Mouse Monoclonal Antibody to DHX58

Sign In for Pricing
View Details