Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human ICOS/CRP-1/AILIM/CD278 (C-Fc)

Source: Human Cells. MW :40.8kD. Recombinant Human Inducible T-cell costimulator is produced by our Mammalian expression system and the target gene encoding Glu21-Phe141 is expressed with a Fc tag at the C-terminus. Inducible T-cell costimulator, also known as activation-inducible lymphocyte immunomediatory molecule, CD278, AILIM, CVID1 and ICOS, belongs to the CD28 and CTLA4 cell surface receptor family.. ICOS contains one Ig-like V-type domain and exsits as a homodimer with disulfide-linked. ICOS is highly expressed on tonsillar T-cellsand can be induced by PMA and ionomycin, ICOS plays an important role in cell-cell signaling, immune responses, and regulation of cell proliferation. Defects in ICOS are the cause of immunodeficiency common variable type 1, which is a primary immunodeficiency characterized by antibody deficiency, hypogammaglobulinemia, recurrent bacterial infections and an inability to mount an antibody response to antige

Product Specifications

Gene Name

ICOS

Gene ID

29851

UniProt

Q9Y6W8

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 .

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

EINGSANYEMFIFHNGGVQILCKYPDIVQQFKMQLLKGGQILCDLTKTKGSGNTVSIKSLKFCHSQLSNNSVSFFLYNLDHSHANYYFCNLSIFDPPPFKVTLTGGYLHIYESQLCCQLKFVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

ART1, NT (GPI-linked NAD (P) (+) -arginine ADP-ribosyltransferase 1, Mono (ADP-ribosyl) Transferase, CD296)
A3577-90 200 µL

ART1, NT (GPI-linked NAD (P) (+) -arginine ADP-ribosyltransferase 1, Mono (ADP-ribosyl) Transferase, CD296)

Ask
View Details
ACE (Angiotensin-converting Enzyme, Dipeptidyl Carboxypeptidase I, Kininase II, CD143, Angiotensin-converting Enzyme, Soluble Form, DCP, DCP1) (HRP)
122870-HRP 100 µL

ACE (Angiotensin-converting Enzyme, Dipeptidyl Carboxypeptidase I, Kininase II, CD143, Angiotensin-converting Enzyme, Soluble Form, DCP, DCP1) (HRP)

Ask
View Details
C1orf103 Polyclonal Antibody, RBITC Conjugated
bs-9797R-RBITC 100 µL

C1orf103 Polyclonal Antibody, RBITC Conjugated

Ask
View Details
Recombinant Human Motile sperm domain-containing protein 2 (MOSPD2)
MBS7020635-01 0.02 mg

Recombinant Human Motile sperm domain-containing protein 2 (MOSPD2)

Ask
View Details
Recombinant Human Motile sperm domain-containing protein 2 (MOSPD2)
MBS7020635-02 0.1 mg

Recombinant Human Motile sperm domain-containing protein 2 (MOSPD2)

Ask
View Details
Recombinant Human Motile sperm domain-containing protein 2 (MOSPD2)
MBS7020635-03 5x 0.1 mg

Recombinant Human Motile sperm domain-containing protein 2 (MOSPD2)

Ask
View Details