Recombinant Mouse Fibrillin-1/Asprosin (N-8His)
Source: Human Cells. MW :16.9kD. Recombinant Mouse Fibrillin-1 is produced by our Mammalian expression system and the target gene encoding Ser2732-His2871 is expressed with a 8His tag at the N-terminus. Asprosin is a protein hormone that is produced by white adipose tissue in mammals (and potentially by other tissues), which is then transported to the liver and stimulates it to release glucose into the blood stream. In the liver asprosin activates rapid glucose release by a cAMP-dependent pathway. The glucose release by the liver into the blood stream is vital for brain function and survival during fasting. People with neonatal progeroid syndrome lack asprosin, while people with insulin resistance have it in abundance. In animal tests asprosin showed potential for treating type 2 diabetes. When antibodies targeting asprosin were injected into diabetic mice, blood glucose and insulin levels improved.
Product Specifications
Gene Name
Fbn1
Gene ID
14118
UniProt
Q61554
Components
Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.
Shipping Conditions
The product is shipped at ambient temperature.
Storage Conditions
Applications Notes
Amino Acids
HHHHHHHHSTNETDASDIQDGSEMEANVSLASWDVEKPASFAFNISHVSNKVRILELLPALTTLMNHNRYLIESGNEDGFFKINQKEGVSYLHFTKKNAVAGTYSLQISSTPLYKKKELNQLEDRYDKDYLSGELGDNLKMKIQILLH
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items