Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Fibrillin-1/Asprosin (N-8His)

Source: Human Cells. MW :16.9kD. Recombinant Mouse Fibrillin-1 is produced by our Mammalian expression system and the target gene encoding Ser2732-His2871 is expressed with a 8His tag at the N-terminus. Asprosin is a protein hormone that is produced by white adipose tissue in mammals (and potentially by other tissues), which is then transported to the liver and stimulates it to release glucose into the blood stream. In the liver asprosin activates rapid glucose release by a cAMP-dependent pathway. The glucose release by the liver into the blood stream is vital for brain function and survival during fasting. People with neonatal progeroid syndrome lack asprosin, while people with insulin resistance have it in abundance. In animal tests asprosin showed potential for treating type 2 diabetes. When antibodies targeting asprosin were injected into diabetic mice, blood glucose and insulin levels improved.

Product Specifications

Gene Name

Fbn1

Gene ID

14118

UniProt

Q61554

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

HHHHHHHHSTNETDASDIQDGSEMEANVSLASWDVEKPASFAFNISHVSNKVRILELLPALTTLMNHNRYLIESGNEDGFFKINQKEGVSYLHFTKKNAVAGTYSLQISSTPLYKKKELNQLEDRYDKDYLSGELGDNLKMKIQILLH

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

TTF2 Polyclonal Antibody
MBS9128323-01 0.02 mL

TTF2 Polyclonal Antibody

Ask
View Details
TTF2 Polyclonal Antibody
MBS9128323-02 0.1 mL

TTF2 Polyclonal Antibody

Ask
View Details
TTF2 Polyclonal Antibody
MBS9128323-03 5x 0.1 mL

TTF2 Polyclonal Antibody

Ask
View Details
STKLD1, Human (sf9, His, GST)
HY-P703396 1 Each

STKLD1, Human (sf9, His, GST)

Ask
View Details
Rabbit anti-SMG7 Antibody, Affinity Purified
MBS3902595-01 0.002 mg

Rabbit anti-SMG7 Antibody, Affinity Purified

Ask
View Details
Rabbit anti-SMG7 Antibody, Affinity Purified
MBS3902595-02 0.02 mg

Rabbit anti-SMG7 Antibody, Affinity Purified

Ask
View Details