Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse LAIR1 (C-6His)

Source: Human Cells. MW :14.4kD. Recombinant Mouse Leukocyte-associated Immunoglobulin-like Receptor 1 is produced by our Mammalian expression system and the target gene encoding Gln22-Tyr141 is expressed with a 6His tag at the C-terminus. Leukocyte-associated Ig-like receptor-1 (LAIR-1) is an inhibitory receptor of the Ig superfamily that is structurally related to inhibitory members of KIR and ILT/CD85 families. It is expressed on immune cells, including NK cells, T cells, B cells, monocytes, immature neutrophils, dendritic cells and most thymocytes.The 253 amino acid (aa) type I transmembrane (TM) protein contains a 21 aa signal sequence, a 124 aa extracellular domain (ECD), a 20 aa TM domain and a 98 aa cytoplasmic domain. The ECD includes one C2-type Ig-like domain and two potential N-linked glycosylation sites. Tyrosine phosphorylation of two cytoplasmic ITIM motifs results in recruitment of phosphatases and down-regulation of signaling through activating receptors. LAIR1 shows high-affinity binding of collagens that results in inhibition of degranulation in a basophilic leukemia cell line.

Product Specifications

Gene Name

Lair1

Gene ID

52855

UniProt

Q8BG84

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

QEGSLPDITIFPNSSLMISQGTFVTVVCSYSDKHDLYNMVRLEKDGSTFMEKSTEPYKTEDEFEIGPVNETITGHYSCIYSKGITWSERSKTLELKVIKENVIQTPAPGPTSDTSWLKTYHHHHHH

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

HMMR siRNA (Human)
MBS8215239-01 15 nmol

HMMR siRNA (Human)

Ask
View Details
HMMR siRNA (Human)
MBS8215239-02 30 nmol

HMMR siRNA (Human)

Ask
View Details
HMMR siRNA (Human)
MBS8215239-03 5x 30 nmol

HMMR siRNA (Human)

Ask
View Details
NETO2 Antibody
MBS9608615-01 0.1 mL

NETO2 Antibody

Ask
View Details
NETO2 Antibody
MBS9608615-02 0.2 mL

NETO2 Antibody

Ask
View Details
NETO2 Antibody
MBS9608615-03 5x 0.2 mL

NETO2 Antibody

Ask
View Details