Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse LAIR1 (C-6His)

Source: Human Cells. MW :14.4kD. Recombinant Mouse Leukocyte-associated Immunoglobulin-like Receptor 1 is produced by our Mammalian expression system and the target gene encoding Gln22-Tyr141 is expressed with a 6His tag at the C-terminus. Leukocyte-associated Ig-like receptor-1 (LAIR-1) is an inhibitory receptor of the Ig superfamily that is structurally related to inhibitory members of KIR and ILT/CD85 families. It is expressed on immune cells, including NK cells, T cells, B cells, monocytes, immature neutrophils, dendritic cells and most thymocytes.The 253 amino acid (aa) type I transmembrane (TM) protein contains a 21 aa signal sequence, a 124 aa extracellular domain (ECD), a 20 aa TM domain and a 98 aa cytoplasmic domain. The ECD includes one C2-type Ig-like domain and two potential N-linked glycosylation sites. Tyrosine phosphorylation of two cytoplasmic ITIM motifs results in recruitment of phosphatases and down-regulation of signaling through activating receptors. LAIR1 shows high-affinity binding of collagens that results in inhibition of degranulation in a basophilic leukemia cell line.

Product Specifications

Gene Name

Lair1

Gene ID

52855

UniProt

Q8BG84

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

QEGSLPDITIFPNSSLMISQGTFVTVVCSYSDKHDLYNMVRLEKDGSTFMEKSTEPYKTEDEFEIGPVNETITGHYSCIYSKGITWSERSKTLELKVIKENVIQTPAPGPTSDTSWLKTYHHHHHH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Serine/threonine-protein kinase PLK1 (PLK1) ELISA Kit
EK8434 48 Tests

Mouse Serine/threonine-protein kinase PLK1 (PLK1) ELISA Kit

Sign In for Pricing
View Details
Avian Chondroitin Sulfate (CS) ELISA Kit-Competitive
EK1F659 96 Tests

Avian Chondroitin Sulfate (CS) ELISA Kit-Competitive

Sign In for Pricing
View Details
Elab Bright™ Violet 510 Anti-Mouse CD86 Antibody[GL-1]
E-AB-F0994R1 50 Tests

Elab Bright™ Violet 510 Anti-Mouse CD86 Antibody[GL-1]

Sign In for Pricing
View Details
Neto1 sgRNA CRISPR Lentivector (Rat) (Target 2)
K6536803 1.0 µg DNA

Neto1 sgRNA CRISPR Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
Rabbit Polyclonal mGluR1 Antibody [Allophycocyanin]
NB100-93555APC 0.1 mL

Rabbit Polyclonal mGluR1 Antibody [Allophycocyanin]

Sign In for Pricing
View Details
Lrrc25 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K3598206 1.0 µg DNA

Lrrc25 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details