Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Interleukin-5 Receptor Subunit Alpha/IL-5 Ra (C-6His)

Source: Human Cells. MW :37.6kD. Recombinant Mouse Interleukin-5 Receptor Subunit Alpha is produced by our Mammalian expression system and the target gene encoding Asp18-His339 is expressed with a 6His tag at the C-terminus. Interleukin 5 Receptor alpha (IL-5 Ra), also known as CD125, is a hematopoietin receptor that plays a dominant role in eosinophil biology. Mature mouse IL-5 Ra consists of a 322 amino acid (aa) extracellular domain (ECD) with a WSxWS motif and a four cysteine motif, a 22 aa transmembrane segment, and a 54 aa cytoplasmic domain. The high affinity receptor for IL-5 is a complex that consists of the ligand binding IL-5 Ra and the transmembrane common beta chain (betac/CD131) which is shared with the receptor complexes for IL-3 and GM-CSF. IL-5 Ra binds IL-5 at low affinity and then associates with preformed betac oligomers to form the signaling-competent receptor complex. IL-5 stimulation of CD34+ hematopoietic progenitor cells induces the up-regulation of transmembrane IL-5 Ra followed by eosinophilic differentiation and activation. IL-5 Ra also promotes the differentiation of basophils and B cells. Exposure of mature eosinophils to IL-5 attenuates their IL-5 responsiveness by inducing the down-regulation of surface IL-5 Ra and increased production of soluble IL-5 Ra.

Product Specifications

Gene Name

Il5ra

Gene ID

16192

UniProt

P21183

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

DLLNHKKFLLLPPVNFTIKATGLAQVLLHWDPNPDQEQRHVDLEYHVKINAPQEDEYDTRKTESKCVTPLHEGFAASVRTILKSSHTTLASSWVSAELKAPPGSPGTSVTNLTCTTHTVVSSHTHLRPYQVSLRCTWLVGKDAPEDTQYFLYYRFGVLTEKCQEYSRDALNRNTACWFPRTFINSKGFEQLAVHINGSSKRAAIKPFDQLFSPLAIDQVNPPRNVTVEIESNSLYIQWEKPLSAFPDHCFNYELKIYNTKNGHIQKEKLIANKFISKIDDVSTYSIQVRAAVSSPCRMPGRWGEWSQPIYVGKERKSLVEWHHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Biotin-Linked Monoclonal Antibody to Troponin I Type 3, Cardiac (TNNI3)
MBS2090867-01 0.1 mL

Biotin-Linked Monoclonal Antibody to Troponin I Type 3, Cardiac (TNNI3)

Ask
View Details
Biotin-Linked Monoclonal Antibody to Troponin I Type 3, Cardiac (TNNI3)
MBS2090867-02 0.2 mL

Biotin-Linked Monoclonal Antibody to Troponin I Type 3, Cardiac (TNNI3)

Ask
View Details
Biotin-Linked Monoclonal Antibody to Troponin I Type 3, Cardiac (TNNI3)
MBS2090867-03 0.5 mL

Biotin-Linked Monoclonal Antibody to Troponin I Type 3, Cardiac (TNNI3)

Ask
View Details
Biotin-Linked Monoclonal Antibody to Troponin I Type 3, Cardiac (TNNI3)
MBS2090867-04 1 mL

Biotin-Linked Monoclonal Antibody to Troponin I Type 3, Cardiac (TNNI3)

Ask
View Details
Biotin-Linked Monoclonal Antibody to Troponin I Type 3, Cardiac (TNNI3)
MBS2090867-05 5 mL

Biotin-Linked Monoclonal Antibody to Troponin I Type 3, Cardiac (TNNI3)

Ask
View Details
Biotin-Linked Monoclonal Antibody to Troponin I Type 3, Cardiac (TNNI3)
MBS2090867-06 5x 5 mL

Biotin-Linked Monoclonal Antibody to Troponin I Type 3, Cardiac (TNNI3)

Ask
View Details