Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse IL-9

Source: Human Cells. MW :15.2kD. Recombinant Mouse Interleukin-9 is produced by our Mammalian expression system and the target gene encoding Gln19-Pro144 is expressed with a 6His tag at the C-terminus. Interleukin-9 (IL-9) is a secreted protein that belongs to the IL-7/IL-9 family.Mature mouse IL-9 shares 57% and 74% amino acid sequence identity with human and rat IL-9, respectively. IL-9 supports IL-2 independent and IL-4 independent growth of helper T-cells. IL-9 stimulates cell proliferation and prevents apoptosis. It functions through the IL-9 receptor (IL-9R), which activates different signal transducer and activator (STAT) proteins and thus connects this cytokine to various biological processes. IL-9 has been identified as a candidate gene for asthma. IL-9 is a determining factor in the pathogenesis of bronchial hyperresponsiveness.

Product Specifications

Gene Name

Il9

Gene ID

16198

UniProt

P15247

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

QRCSTTWGIRDTNYLIENLKDDPPSKCSCSGNVTSCLCLSVPTDDCTTPCYREGLLQLTNATQKSRLLPVFHRVKRIVEVLKNITCPSFSCEKPCNQTMAGNTLSFLKSLLGTFQKTEMQRQKSRPVDHHHHHH

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Anti-Indoleamine 2, 3-dioxygenase  (4F9)
YF-MA13813 100 ug

Anti-Indoleamine 2, 3-dioxygenase (4F9)

Ask
View Details
Commd7 Mouse shRNA Plasmid (Locus ID 99311)
TL512493 1 Kit

Commd7 Mouse shRNA Plasmid (Locus ID 99311)

Ask
View Details
IGFBP6 rabbit pAb
ES4091-01 50 µL

IGFBP6 rabbit pAb

Ask
View Details
IGFBP6 rabbit pAb
ES4091-02 100 µL

IGFBP6 rabbit pAb

Ask
View Details
Protein Inhibitor of Activated STAT3 (PIAS3) Antibody
abx013225-01 10 µg

Protein Inhibitor of Activated STAT3 (PIAS3) Antibody

Ask
View Details
Protein Inhibitor of Activated STAT3 (PIAS3) Antibody
abx013225-02 100 µg

Protein Inhibitor of Activated STAT3 (PIAS3) Antibody

Ask
View Details