Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse IL-9

Source: Human Cells. MW :15.2kD. Recombinant Mouse Interleukin-9 is produced by our Mammalian expression system and the target gene encoding Gln19-Pro144 is expressed with a 6His tag at the C-terminus. Interleukin-9 (IL-9) is a secreted protein that belongs to the IL-7/IL-9 family.Mature mouse IL-9 shares 57% and 74% amino acid sequence identity with human and rat IL-9, respectively. IL-9 supports IL-2 independent and IL-4 independent growth of helper T-cells. IL-9 stimulates cell proliferation and prevents apoptosis. It functions through the IL-9 receptor (IL-9R), which activates different signal transducer and activator (STAT) proteins and thus connects this cytokine to various biological processes. IL-9 has been identified as a candidate gene for asthma. IL-9 is a determining factor in the pathogenesis of bronchial hyperresponsiveness.

Product Specifications

Gene Name

Il9

Gene ID

16198

UniProt

P15247

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

QRCSTTWGIRDTNYLIENLKDDPPSKCSCSGNVTSCLCLSVPTDDCTTPCYREGLLQLTNATQKSRLLPVFHRVKRIVEVLKNITCPSFSCEKPCNQTMAGNTLSFLKSLLGTFQKTEMQRQKSRPVDHHHHHH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chicken Protease Serine 2 (PRSS2) ELISA Kit
NSL0313Ch 96 Tests

Chicken Protease Serine 2 (PRSS2) ELISA Kit

Sign In for Pricing
View Details
JAK2 Rabbit Monoclonal Antibody
E10G22711 100 µL

JAK2 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
FBXO9 Antibody
orb1249775 0.05 mg

FBXO9 Antibody

Sign In for Pricing
View Details
Recombinant Laticauda colubrina Phospholipase A2 isozyme 2
MBS1016119-01 0.02 mg (E-Coli)

Recombinant Laticauda colubrina Phospholipase A2 isozyme 2

Sign In for Pricing
View Details
Recombinant Laticauda colubrina Phospholipase A2 isozyme 2
MBS1016119-02 0.1 mg (E-Coli)

Recombinant Laticauda colubrina Phospholipase A2 isozyme 2

Sign In for Pricing
View Details
Recombinant Laticauda colubrina Phospholipase A2 isozyme 2
MBS1016119-03 0.02 mg (Yeast)

Recombinant Laticauda colubrina Phospholipase A2 isozyme 2

Sign In for Pricing
View Details