Recombinant Mouse Cathepsin D/CSTD (C-6His)

Source: Human Cells. MW :43.9kD. Recombinant Mouse Cathepsin D is produced by our Mammalian expression system and the target gene encoding Ile21-Leu410 is expressed with a 6His tag at the C-terminus. CTSD localizes to the lysosome and consists of a light chain and a heavy chain. CTSD is expressed in epithelial cells as well as in macrophages.CTSD is a lysosomal aspartyl protease that depends critically on protonation of its active site Asp residue and gets activated at pH 5 in endosome of hepatocytes. It has been suggested to facilitate cancer cell migration and invasion by digesting the basement membrane, extracellular matrix and xonnective tissue. In addition, CTSD has been used as a breast cancer tumor marker.

Product Specifications

Gene Name

Ctsd

Gene ID

13033

UniProt

P18242

Components

Lyophilized from a 0.2 μm filtered solution of 20mM MES,150mM NaCl, pH5.5.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

IIRIPLRKFTSIRRTMTEVGGSVEDLILKGPITKYSMQSSPKTTEPVSELLKNYLDAQYYGDIGIGTPPQCFTVVFDTGSSNLWVPSIHCKILDIACWVHHKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCKSDQSKARGIKVEKQIFGEATKQPGIVFVAAKFDGILGMGYPHISVNNVLPVFDNLMQQKLVDKNIFSFYLNRDPEGQPGGELMLGGTDSKYYHGELSYLNVTRKAYWQVHMDQLEVGNELTLCKGGCEAIVDTGTSLLVGPVEEVKELQKAIGAVPLIQGEYMIPCEKVSSLPTVYLKLGGKNYELHPDKYILKVSQGGKTICLSGFMGMDIPPPSGPLWILGDVFIGSYYTVFDRDNNRVGFANAVVLVDHHHHHH