Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Collagen Alpha-1 (XVIII) Chain/Endostatin (C-6His)

Source: Human Cells. MW :21.2kD. Recombinant Mouse Collagen alpha-1 (XVIII) chain is produced by our expression system and the target gene encoding His1591-Lys1774 is expressed Endostatin, an endogenous non-glycosylated inhibitor of endothelial cell proliferation and angiogenesis. It is produced and/or trimmed by metalloproteinases such as MMP-2 and MMP-9, and cathepsins S, B and L. The N-terminal ~27 aa of Endostatin appear to contain the majority of its activity. This region contains zinc binding sites that are thought to be critical for its anti-endothelial and anti-tumor effects, as well as multiple cleavage sites that, when used, can modify its activity. Mouse Endostatin shares 96% aa sequence identity with rat and 85-87% with human, bovine and equine Endostatin. It is predominantly expressed in liver, kidney, lung, skeletal muscle and testis. Endostatin inhibits endothelial cell growth by inducing cell cycle arrest in G1 phase and initiating apoptosis. It is also thought to down-regulate angiogenesis by blocking VEGF-induced endothelial cell migration. Endostatin may also be involved with down-regulation of angiogenesis after establishment of placental circulation in the pregnant uterus.

Product Specifications

Gene Name

Col18a1

Gene ID

12822

UniProt

P39061

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 .

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

HTHQDFQPVLHLVALNTPLSGGMRGIRGADFQCFQQARAVGLSGTFRAFLSSRLQDLYSIVRRADRGSVPIVNLKDEVLSPSWDSLFSGSQGQLQPGARIFSFDGRDVLRHPAWPQKSVWHGSDPSGRRLMESYCETWRTETTGATGQASSLLSGRLLEQKAASCHNSYIVLCIENSFMTSFSKHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Mouse Monoclonal Mesothelin Antibody (MB-G10) [Alexa Fluor 647]
NB110-85538AF647 0.1 mL

Mouse Monoclonal Mesothelin Antibody (MB-G10) [Alexa Fluor 647]

Ask
View Details
Recombinant Eubacterium sp. AM18-10LB-B cas9 protein, N-His Tag
MBS1563020-01 0.05 mg

Recombinant Eubacterium sp. AM18-10LB-B cas9 protein, N-His Tag

Ask
View Details
Recombinant Eubacterium sp. AM18-10LB-B cas9 protein, N-His Tag
MBS1563020-02 0.1 mg

Recombinant Eubacterium sp. AM18-10LB-B cas9 protein, N-His Tag

Ask
View Details
Recombinant Eubacterium sp. AM18-10LB-B cas9 protein, N-His Tag
MBS1563020-03 5x 0.1 mg

Recombinant Eubacterium sp. AM18-10LB-B cas9 protein, N-His Tag

Ask
View Details
SCP-3 Monoclonal Antibody
BT-MCA1124-01 50 µL

SCP-3 Monoclonal Antibody

Ask
View Details
SCP-3 Monoclonal Antibody
BT-MCA1124-02 100 µL

SCP-3 Monoclonal Antibody

Ask
View Details