Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Natural Cytotoxicity Triggering Receptor 1/NCR1 (C-6His)

Source: Human Cells. MW :53.5kD. Recombinant Mouse Natural cytotoxicity triggering receptor 1 is produced by our expression system and the target gene encoding Glu22-Asn255 is expressed Natural cytotoxicity triggering receptor 1 (NKp46/NCR1) is a single-pass type I membrane protein. It consists of two extracellular Ig-like domains followed by a short stalk region, a transmembrane domain containing a positively charged amino acid residue, and a short cytoplasmictail. NKp46 is predominantly expressed in the embryo. It has a positive charge in its transmembrane domain that permits association with the ITAM-bearing signal adapter proteins, CD3 zeta and Fc epsilon RI gamma. These receptors are expressed almost exclusively by NK cells and play a major role in triggering some of the key lytic activities of NK cells. Studies with neutralizing antibodies indicate that the three NCR are primarily responsible for triggering the NK-mediated lysis of many human tumor celllines.

Product Specifications

Gene Name

Ncr1

Gene ID

17086

UniProt

Q8C567

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 .

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

EKETLPKPIIWAKPSIMVTNGNSVNIWCQGAQSASEYQLYFEGSFFALERPKPSRSMNKVRFFISQMTSHTAGIYTCFYQSGELWSKSSNPLKLVVTGLYDTPNLWVYPRPEVTLGENVTFFCQLKTATSKFFLLKERGSNHIQNKYGNIQAEFPMGPVTRAHRGTYRCFGSYNDYAWSFPSEPVTLLITGGVENSSLAPTDPTSSLDYWEFDLSTNESGLQKDSAFWDHTTQNDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pmel17 / gp100 / SILV (NKI-beteb), CF647 conjugate, 0.1mg/mL
BNC470226-500 1x 500 µL

Pmel17 / gp100 / SILV (NKI-beteb), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (VU-1D9), CF640R conjugate, 0.1mg/mL
BNC400017-100 1x 100 µL

Ep-CAM / CD326 (VU-1D9), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (ICO-115), CF555 conjugate, 0.1mg/mL
BNC550039-500 1x 500 µL

CD34 (ICO-115), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P21 / WAF1 (WA-1), CF594 conjugate, 0.1mg/mL
BNC940043-100 1x 100 µL

P21 / WAF1 (WA-1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P21 / WAF1 (WA-1), CF740 conjugate, 0.1mg/mL
BNC740043-500 1x 500 µL

P21 / WAF1 (WA-1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD53 (161-2), CF568 conjugate, 0.1mg/mL
BNC680324-500 1x 500 µL

CD53 (161-2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details