Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transforming Growth Factor Receptor Type II/TGFBR2 (C-Fc)

Source: Human Cells. MW :42.6kD. Recombinant Human TGF beta receptor II is produced by our Mammalian expression system and the target gene encoding Thr23-Asp159 is expressed with a Fc tag at the C-terminus. TGFBR2 is a single-pass type I membrane protein and contains one protein kinase domain. TGFBR2 exsits as a heterodimeric complex with another receptor protein and binds TGF-beta. Signals triggered through the TGF-beta receptor complex prompt various responses by the cell. One such response is to inhibit cell growth and division. Based on this action, the TGF-beta receptor type 2 is sometimes called a tumor suppressor. Defects in TGFBR2 have been associated with Marfan syndrome, Loeys-Deitz aortic aneurysm syndrome, Osler-Weber-Rendu syndrome and the development of various types of tumors.

Product Specifications

Gene Name

TGFBR2

Gene ID

7048

UniProt

P37173

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.2.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

TIPPHVQKSVNNDMIVTDNNGAVKFPQLCKFCDVRFSTCDNQKSCMSNCSITSICEKPQEVCVAVWRKNDENITLETVCHDPKLPYHDFILEDAASPKCIMKEKKKPGETFFMCSCSSDECNDNIIFSEEYNTSNPDVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Recombinant Mycobacterium tuberculosis Uncharacterized membrane protein ArfB (arfB), partial
MBS1040169-01 0.5 mg (E-Coli)

Recombinant Mycobacterium tuberculosis Uncharacterized membrane protein ArfB (arfB), partial

Ask
View Details
Recombinant Mycobacterium tuberculosis Uncharacterized membrane protein ArfB (arfB), partial
MBS1040169-02 0.05 mg (Baculovirus)

Recombinant Mycobacterium tuberculosis Uncharacterized membrane protein ArfB (arfB), partial

Ask
View Details
Recombinant Mycobacterium tuberculosis Uncharacterized membrane protein ArfB (arfB), partial
MBS1040169-03 0.5 mg (Yeast)

Recombinant Mycobacterium tuberculosis Uncharacterized membrane protein ArfB (arfB), partial

Ask
View Details
Recombinant Mycobacterium tuberculosis Uncharacterized membrane protein ArfB (arfB), partial
MBS1040169-04 0.05 mg (Mammalian-Cell)

Recombinant Mycobacterium tuberculosis Uncharacterized membrane protein ArfB (arfB), partial

Ask
View Details
Recombinant Mycobacterium tuberculosis Uncharacterized membrane protein ArfB (arfB), partial
MBS1040169-05 1 mg (E-Coli)

Recombinant Mycobacterium tuberculosis Uncharacterized membrane protein ArfB (arfB), partial

Ask
View Details
Recombinant Mycobacterium tuberculosis Uncharacterized membrane protein ArfB (arfB), partial
MBS1040169-06 0.1 mg (Baculovirus)

Recombinant Mycobacterium tuberculosis Uncharacterized membrane protein ArfB (arfB), partial

Ask
View Details