Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transcobalamin II Receptor/TCblR/8D6A/CD320 (C-6His)

Source: Human Cells. MW :21.1kD. Recombinant Human Transcobalamin II Receptor is produced by our Mammalian expression system and the target gene encoding Ser36-Val231 is expressed with a 6His tag at the C-terminus. CD320 antigen is also known as 8D6 antigen, FDC-signaling molecule 8D6, Transcobalamin receptor and 8D6A. It is a single-pass type I membrane protein and containing two LDL-receptor class A domains. CD320 has been recently discovered and reported as a follicular dendritic cell (FDC) protein. CD320 can augments the proliferation of plasma cells precursors generated by IL-10. CD320 also founctions a receptor for the cellular uptake of transcobalamin bound cobalamin. Defects in CD320 are the cause of methylmalonic aciduria type TCblR (MMATC) which is a metabolic disorder.

Product Specifications

Gene Name

CD320

Gene ID

51293

UniProt

Q9NPF0

Components

Lyophilized from a 0.2 μm filtered solution of 10mM Tris-Citrate,150mM NaCl, pH 7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

SPLSTPTSAQAAGPSSGSCPPTKFQCRTSGLCVPLTWRCDRDLDCSDGSDEEECRIEPCTQKGQCPPPPGLPCPCTGVSDCSGGTDKKLRNCSRLACLAGELRCTLSDDCIPLTWRCDGHPDCPDSSDELGCGTNEILPEGDATTMGPPVTLESVTSLRNATTMGPPVTLESVPSVGNATSSSAGDQSGSPTAYGVVDHHHHHH
More Discoveries

Explore Other Products

Browse additional items from our catalog

Cyp2c54 shRNA (m) Lentiviral Particles
sc-142683-V 200 µL

Cyp2c54 shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details
Recombinant Rat CCL5/ RANTES Protein, Untagged, E.coli-20ug
QP5513-20ug 20ug

Recombinant Rat CCL5/ RANTES Protein, Untagged, E.coli-20ug

Sign In for Pricing
View Details
Aoc3 Mouse shRNA Plasmid (Locus ID 11754)
TR500100 1 Kit

Aoc3 Mouse shRNA Plasmid (Locus ID 11754)

Sign In for Pricing
View Details
Rat Prefoldin Subunit 2 (PFDN2) ELISA Kit
MBS9395831-01 48 Well

Rat Prefoldin Subunit 2 (PFDN2) ELISA Kit

Sign In for Pricing
View Details
Rat Prefoldin Subunit 2 (PFDN2) ELISA Kit
MBS9395831-02 96 Well

Rat Prefoldin Subunit 2 (PFDN2) ELISA Kit

Sign In for Pricing
View Details
Rat Prefoldin Subunit 2 (PFDN2) ELISA Kit
MBS9395831-03 5x 96 Well

Rat Prefoldin Subunit 2 (PFDN2) ELISA Kit

Sign In for Pricing
View Details