Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Granulocyte-Macrophage Colony-Stimulating Factor/GM-CSF (C-6His)

Source: Human Cells. MW :15.6kD. Recombinant Rat Granulocyte-Macrophage Colony-Stimulating Factor is produced by our Mammalian expression system and the target gene encoding Ala18-Lys144 is expressed with a 6His tag at the C-terminus. Granulocyte-Macrophage Colony Stimulating Factor (GM-CSF) was initially characterized as a growth factorthat can support the in vitro colony formation of granulocyte-macrophage progenitors. It is produced by anumber of different cell types (including activated T cells, B cells, macrophages, mast cells, endothelial cellsand fibroblasts) in response to cytokine of immune and inflammatory stimuli. Besides granulocyte-macrophageprogenitors, GM-CSF is also a growth factor for erythroid, megakaryocyte and eosinophil progenitors. Onmature hematopoietic, monocytes/ macrophages and eosinophils. GM-CSF has a functional role on nonhematopoitic cells. It can induce human endothelial cells to migrate and proliferate. Additionally, GM-CSF canalso stimulate the proliferation of a number of tumor cell lines, including osteogenic sarcoma, carcinoma andadenocarcinoma cell lines.

Product Specifications

Gene Name

Csf2

Gene ID

116630

UniProt

P48750

Components

Lyophilized from a 0.2 μm filtered solution of PBS pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

APTRSPNPVTRPWKHVDAIKEALSLLNDMRALENEKNEDVDIISNEFSIQRPTCVQTRLKLYKQGLRGNLTKLNGALTMIASHYQTNCPPTPETDCEIEVTTFEDFIKNLKGFLFDIPFDCWKPVQKVDHHHHHH

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

FBP1, ID (Fructose-1,6-bisphosphatase 1, FBPase 1, D-fructose-1,6-bisphosphate 1-phosphohydrolase 1, FBP) (MaxLight 750) discontinued
F8010-02A-ML750 100 µL

FBP1, ID (Fructose-1,6-bisphosphatase 1, FBPase 1, D-fructose-1,6-bisphosphate 1-phosphohydrolase 1, FBP) (MaxLight 750) discontinued

Ask
View Details
Mouse Monoclonal VISTA/B7-H5/PD-1H Antibody (730823) [PE/Cy7]
MAB71263PECY7 0.1 mL

Mouse Monoclonal VISTA/B7-H5/PD-1H Antibody (730823) [PE/Cy7]

Ask
View Details
LTBR Polyclonal Antibody, PE Conjugated
bs-6917R-PE 100 µL

LTBR Polyclonal Antibody, PE Conjugated

Ask
View Details
PentatricoPeptide repeat-containing protein 3 mitochondrial (PTCD3) Human ELISA Kit
F7492 96 Tests

PentatricoPeptide repeat-containing protein 3 mitochondrial (PTCD3) Human ELISA Kit

Ask
View Details
Prkab1 (NM_031869) Mouse Recombinant Protein
PM47720M5 20 µg

Prkab1 (NM_031869) Mouse Recombinant Protein

Ask
View Details
ANKMY1
306057-01 50 µL

ANKMY1

Ask
View Details