Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human SLAM Family Member 2/CD48 (C-Fc-6His)

Source: Human Cells. MW :53.1kD. Recombinant Human SLAMF2 is produced by our Mammalian expression system and the target gene encoding Gln27-Ser220 is expressed with a Fc, 6His tag at the C-terminus. CD48 antigen, also known as B-lymphocyte activation marker BLAST-1, BCM1 surface antigen, Leukocyte antigen MEM-102, TCT.1, CD48, BCM1, and BLAST1, CD48 contains one Ig-like C2-type domain and one Ig-like V-type domain, but does not have a transmembrane domain, however, but is held at the cell surface by a GPI anchor via a C-terminal domain which maybe cleaved to yield a soluble form of the receptor. CD48 may facilitate interaction between activated lymphocytes and be involved in regulating T-cell activation. CD48 plays a vital role as an environmental sensor for regulating progenitor cell numbers and inhibiting tumor development. It is suggested that the anti-CD48 mAb has the potential to become an effective therapeutic mAb against multiple myeloma.

Product Specifications

Gene Name

CD48

Gene ID

962

UniProt

P09326

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.2.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

QGHLVHMTVVSGSNVTLNISESLPENYKQLTWFYTFDQKIVEWDSRKSKYFESKFKGRVRLDPQSGALYISKVQKEDNSTYIMRVLKKTGNEQEWKIKLQVLDPVPKPVIKIEKIEDMDDNCYLKLSCVIPGESVNYTWYGDKRPFPKELQNSVLETTLMPHNYSRCYTCQVSNSVSSKNGTVCLSPPCTLARSVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH
More Discoveries

Explore Other Products

Browse additional items from our catalog

PRPF31 Protein Vector (Mouse) (pPM-C-His)
PV219737 500 ng

PRPF31 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
alpha-N-acetylglucosaminidase/NAGLU Recombinant Protein Antigen
NBP1-82601PEP 0.1 mL

alpha-N-acetylglucosaminidase/NAGLU Recombinant Protein Antigen

Sign In for Pricing
View Details
Asparagine synthetase (ASNS) (NM_001178076) Human Tagged ORF Clone
RC230144 10 µg

Asparagine synthetase (ASNS) (NM_001178076) Human Tagged ORF Clone

Sign In for Pricing
View Details
Mouse ITGA2 siRNA
abx920891-01 15 nmol

Mouse ITGA2 siRNA

Sign In for Pricing
View Details
Mouse ITGA2 siRNA
abx920891-02 30 nmol

Mouse ITGA2 siRNA

Sign In for Pricing
View Details
Arrestin 1 (Phospho-Ser412) Antibody
MBS851547-01 0.1 mg

Arrestin 1 (Phospho-Ser412) Antibody

Sign In for Pricing
View Details