Recombinant Human Fas/TNFRSF6/CD95 (C-6His)

Source: Human Cells. MW :17.6kD. Recombinant Human Fas is produced by our Mammalian expression system and the target gene encoding Gln26-Asn173 is expressed with a 6His tag at the C-terminus. FAS is a receptor and contains three TNFR-Cys repeats and one death domain. It has been shown that FAS is involved in the physiological regulation of programmed cell death, and has been implicated in the pathogenesis of various malignancies and diseases of the immune system. FADD (adapter molecule) recruits caspase-8 to the activated receptor, the resulting death-inducing signaling complex (DISC) performs caspase-8 proteolytic activation which initiates the subsequent cascade of caspases mediating apoptosis. FAS-mediated apoptosis may play a role in the induction of peripheral tolerance, in the antigen-stimulated suicide of mature T-cells, or both.

Product Specifications

Gene Name

FAS

Gene ID

355

UniProt

P25445

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH 7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

QVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCHKPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAHFSSKCRRCRLCDEGHGLEVEINCTRTQNTKCRCKPNFFCNSTVCEHCDPCTKCEHGIIKECTLTSNTKCKEEGSRSNVDHHHHHH