Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Apolipoprotein C-II/APOC2 (C-6His)

Source: E. coli. MW :10kD. Recombinant Human Apolipoprotein C-II is produced by our E.coli expression system and the target gene encoding Met1-Glu82 is expressed with a 6His tag at the C-terminus. APOC2 activates the lipoprotein lipase in capillaries, which hydrolyzes triglycerides and thus provides free fatty acids for cells. APOC2 is component of the very low density lipoprotein (VLDL) fraction in plasma. It is also an activator of several triacylglycerol lipases. The association of APOC2 with plasma chylomicrons, VLDL, and HDL is reversible, a function of the secretion and catabolism of triglyceride-rich lipoproteins, and changes rapidly. Defects in APOC2 are the cause of hyperlipoproteinemia type 1B (HLPP1B) which characterized by hypertriglyceridemia, xanthomas, and increased risk of pancreatitis and early atherosclerosis.

Product Specifications

Gene Name

APOC2

Gene ID

344

UniProt

P02655

Components

Supplied as a 0.2 μm filtered solution of 20mMPB,150mM NaCL,30%glycerol, pH7.2.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MTQQPQQDEMPSPTLLTQVKESLSSYWESAKTAAQNLYEKTYLPAVDEKLRDLYSKSTAAMSTYTGIFTDQVLSVLKGEELEHHHHHH

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Lentiviral mouse Arhgef40 shRNA (UAS) - Lentiviral mouse Arhgef40 shRNA (UAS, iRFP) (25)
GTR15235238 1 Vial

Lentiviral mouse Arhgef40 shRNA (UAS) - Lentiviral mouse Arhgef40 shRNA (UAS, iRFP) (25)

Ask
View Details
Eureka / Constantan Wire, Bare
1091200/6 1 Each

Eureka / Constantan Wire, Bare

Ask
View Details
FTHP2 AAV siRNA Pooled Vector
57711161 1.0 µg

FTHP2 AAV siRNA Pooled Vector

Ask
View Details
Human CD276 (CD276 antigen) QuickTest ELISA Kit
MBS7619462-01 48 Well

Human CD276 (CD276 antigen) QuickTest ELISA Kit

Ask
View Details
Human CD276 (CD276 antigen) QuickTest ELISA Kit
MBS7619462-02 96 Well

Human CD276 (CD276 antigen) QuickTest ELISA Kit

Ask
View Details
Human CD276 (CD276 antigen) QuickTest ELISA Kit
MBS7619462-03 5x 96 Well

Human CD276 (CD276 antigen) QuickTest ELISA Kit

Ask
View Details