Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Activin Receptor 2A/Activin RIIA/ACVR2A (C-Fc-6His)

Source: Human Cells. MW :41.2kD. Recombinant Human Activin Receptor IIA is produced by our Mammalian expression system and the target gene encoding Ala20-Pro134 is expressed with a Fc, 6His tag at the C-terminus. Activin Receptor Type-2A is a protein that in humans is encoded by the ACVR2A gene. ACVR2A is an activin type 2 receptor. This gene encodes activin A type II receptor. Activins are dimeric growth and differentiation factors which belong to the transforming growth factor-beta (TGF-beta) superfamily of structurally related signaling proteins. Activins signal through a heteromeric complex of receptor serine kinases which include at least two type I (I and IB) and two type II (II and IIB) receptors. These receptors are all transmembrane proteins, composed of a ligand-binding extracellular domain with cysteine-rich region, a transmembrane domain, and a cytoplasmic domain with predicted serine/threonine specificity. Type I receptors are essential for signaling; and type II receptors are required for binding ligands and for expression of type I receptors. Type I and II receptors form a stable complex after ligand binding, resulting in phosphorylation of type I receptors by type II receptors. Type II receptors are considered to be constitutively active kinases.

Product Specifications

Gene Name

ACVR2A

Gene ID

92

UniProt

P27037

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

AILGRSETQECLFFNANWEKDRTNQTGVEPCYGDKDKRRHCFATWKNISGSIEIVKQGCWLDDINCYDRTDCVEKKDSPEVYFCCCEGNMCNEKFSYFPEMEVTQPTSNPVTPKPVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH
More Discoveries

Explore Other Products

Browse additional items from our catalog

SCHIP1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1G6]
TA504485BM 100 µL

SCHIP1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1G6]

Sign In for Pricing
View Details
SNRPD1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
44972061 1.0 µg DNA

SNRPD1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Tlr4 sgRNA CRISPR Lentivector set (Mouse)
K4898701 3x 1.0 µg

Tlr4 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
ZNF50 (ZSCAN22) Human Gene Knockout Kit (CRISPR)
KN410960 1 Kit

ZNF50 (ZSCAN22) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Panowamycin B
MF-0025384-01 1 mg

Panowamycin B

Sign In for Pricing
View Details
Panowamycin B
MF-0025384-02 5 mg

Panowamycin B

Sign In for Pricing
View Details