Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Pulmonary Surfactant-associated Protein D/SP-D (C-6His)

Source: Human Cells. MW :36.7kD. Recombinant Mouse Pulmonary Surfactant-associated Protein D is produced by our Mammalian expression system and the target gene encoding Ala20-Phe374 is expressed with a 6His tag at the C-terminus. SP-D (surfactant protein-D) is a 43 kDa member of the collectin family of innate immune modulators. Mouse SP-D cDNA encodes a 19 aa signal sequence and a 355 aa mature region with a 25 aa N-terminal linking-region, a 177 aa hydroxyproline and hydroxylysine collagen-like domain, a 46 aa coiled-coil segment, and a 106 aa, C-terminal collectin-like C-type lectin domain .SP-D is usually found as a glycosylated, disulfide-linked 150 kDa alpha -helical coiled-coil trimer with a “head” of three symmetrical CRDs . SP-D also binds SIRP alpha and the calreticulin/CD91 complex on macrophages.

Product Specifications

Gene Name

Sftpd

Gene ID

20390

UniProt

P50404

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

AEMKSLSQRSVPNTCTLVMCSPTENGLPGRDGRDGREGPRGEKGDPGLPGPMGLSGLQGPTGPVGPKGENGSAGEPGPKGERGLSGPPGLPGIPGPAGKEGPSGKQGNIGPQGKPGPKGEAGPKGEVGAPGMQGSTGAKGSTGPKGERGAPGVQGAPGNAGAAGPAGPAGPQGAPGSRGPPGLKGDRGVPGDRGIKGESGLPDSAALRQQMEALKGKLQRLEVAFSHYQKAALFPDGRSVGDKIFRTADSEKPFEDAQEMCKQAGGQLASPRSATENAAIQQLITAHNKAAFLSMTDVGTEGKFTYPTGEPLVYSNWAPGEPNNNGGAENCVEIFTNGQWNDKACGEQRLVICEFVDHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Recombinant Multidrug resistance protein EbrB (ebrB)
MBS7014121-01 0.02 mg

Recombinant Multidrug resistance protein EbrB (ebrB)

Ask
View Details
Recombinant Multidrug resistance protein EbrB (ebrB)
MBS7014121-02 0.1 mg

Recombinant Multidrug resistance protein EbrB (ebrB)

Ask
View Details
Recombinant Multidrug resistance protein EbrB (ebrB)
MBS7014121-03 5x 0.1 mg

Recombinant Multidrug resistance protein EbrB (ebrB)

Ask
View Details
Rat Tissue Inhibitors Of Metalloproteinase 9 (TIMP-9) ELISA Kit
EIA06447r 1 Kit

Rat Tissue Inhibitors Of Metalloproteinase 9 (TIMP-9) ELISA Kit

Ask
View Details
Angular rotor
E2793 1 Unit

Angular rotor

Ask
View Details
FADD CRISPR Activation Plasmid (h2)
sc-400580-ACT-2 20 µg

FADD CRISPR Activation Plasmid (h2)

Ask
View Details