Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Granulocyte Colony-Stimulating Factor/G-CSF/CSF1 (C-6His)

Source: Human Cells. MW :19.8kD. Recombinant Mouse Granulocyte Colony-Stimulating Factor is produced by our Mammalian expression system and the target gene encoding Val31-Ala208 is expressed with a 6His tag at the C-terminus. Granulocyte colony-stimulating factor (G-CSF) is a growth factor and an essential cytokine which belongs to the IL-6 superfamily. Granulocyte/macrophage colony-stimulating factors are cytokines that act in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages. G-CSF binding to its receptor G-CSF-R which belongs to the cytokine receptor type I family depends on the interaction of alpha-helical motifs of the former and two fibronectin type III as well as an immunoglobulin-like domain of the latter. G-CSF is a cytokine that have been demonstrated to improve cardiac function and perfusion in myocardial infarction. And it was initially evaluated as a stem cell mobilizer and erythropoietin as a cytoprotective agent.

Product Specifications

Gene Name

Csf3

Gene ID

12985

UniProt

P09920

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

VPLVTVSALPPSLPLPRSFLLKSLEQVRKIQASGSVLLEQLCATYKLCHPEELVLLGHSLGIPKASLSGCSSQALQQTQCLSQLHSGLCLYQGLLQALSGISPALAPTLDLLQLDVANFATTIWQQMENLGVAPTVQPTQSAMPAFTSAFQRRAGGVLAISYLQGFLETARLALHHLAHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Tough-Spots, large, coffee labels for 1.5 mL and 2.0 mL tubes, 1/2 inch diameter, 1000/roll. For -196C to +80C.
9185-0517 1000 / Roll

Tough-Spots, large, coffee labels for 1.5 mL and 2.0 mL tubes, 1/2 inch diameter, 1000/roll. For -196C to +80C.

Ask
View Details
MMP23B Antibody
GWB-MQ570C 50 µg

MMP23B Antibody

Ask
View Details
Lentiviral human GPR3 sgRNA gene knockout kit - Lentiviral human GPR3 sgRNA gene knockout kit (100)
GTR15355053 1 Vial

Lentiviral human GPR3 sgRNA gene knockout kit - Lentiviral human GPR3 sgRNA gene knockout kit (100)

Ask
View Details
NLRP10 Antibody (C-term) Blocking peptide
MBS9219951-01 0.5 mg

NLRP10 Antibody (C-term) Blocking peptide

Ask
View Details
NLRP10 Antibody (C-term) Blocking peptide
MBS9219951-02 5x 0.5 mg

NLRP10 Antibody (C-term) Blocking peptide

Ask
View Details
Olfr1116 shRNA (m) Lentiviral Particles
sc-150291-V 200 µL

Olfr1116 shRNA (m) Lentiviral Particles

Ask
View Details