Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Granulocyte Colony-Stimulating Factor/G-CSF/CSF1 (C-6His)

Source: Human Cells. MW :19.8kD. Recombinant Mouse Granulocyte Colony-Stimulating Factor is produced by our Mammalian expression system and the target gene encoding Val31-Ala208 is expressed with a 6His tag at the C-terminus. Granulocyte colony-stimulating factor (G-CSF) is a growth factor and an essential cytokine which belongs to the IL-6 superfamily. Granulocyte/macrophage colony-stimulating factors are cytokines that act in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages. G-CSF binding to its receptor G-CSF-R which belongs to the cytokine receptor type I family depends on the interaction of alpha-helical motifs of the former and two fibronectin type III as well as an immunoglobulin-like domain of the latter. G-CSF is a cytokine that have been demonstrated to improve cardiac function and perfusion in myocardial infarction. And it was initially evaluated as a stem cell mobilizer and erythropoietin as a cytoprotective agent.

Product Specifications

Gene Name

Csf3

Gene ID

12985

UniProt

P09920

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

VPLVTVSALPPSLPLPRSFLLKSLEQVRKIQASGSVLLEQLCATYKLCHPEELVLLGHSLGIPKASLSGCSSQALQQTQCLSQLHSGLCLYQGLLQALSGISPALAPTLDLLQLDVANFATTIWQQMENLGVAPTVQPTQSAMPAFTSAFQRRAGGVLAISYLQGFLETARLALHHLAHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Chicken Olfactory Receptor 2F2 (OR2F2) ELISA Kit
MBS7265139-01 48 Well

Chicken Olfactory Receptor 2F2 (OR2F2) ELISA Kit

Ask
View Details
Chicken Olfactory Receptor 2F2 (OR2F2) ELISA Kit
MBS7265139-02 96 Well

Chicken Olfactory Receptor 2F2 (OR2F2) ELISA Kit

Ask
View Details
Chicken Olfactory Receptor 2F2 (OR2F2) ELISA Kit
MBS7265139-03 5x 96 Well

Chicken Olfactory Receptor 2F2 (OR2F2) ELISA Kit

Ask
View Details
Chicken Olfactory Receptor 2F2 (OR2F2) ELISA Kit
MBS7265139-04 10x 96 Well

Chicken Olfactory Receptor 2F2 (OR2F2) ELISA Kit

Ask
View Details
Human Transmembrane protein 187 (TMEM187) ELISA Kit
abx550063 96 Tests

Human Transmembrane protein 187 (TMEM187) ELISA Kit

Ask
View Details
POT1 Polyclonal Antibody
JOT-AP07334-01 50ul

POT1 Polyclonal Antibody

Ask
View Details