Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Folate Receptor Alpha/FOLR1 (C-6His)

Source: Human Cells. MW :25.3kD. Recombinant Mouse Folate Receptor Alpha is produced by our Mammalian expression system and the target gene encoding Thr25-Ser232 is expressed with a 6His tag at the C-terminus. Folate Receptor alpha belongs to the folate receptor family and it is a 37 - 42 kDa protein that mediates the cellular uptake of folic acid and reduced folates.. Mature FOLR1 is an N-glycosylated protein that is anchored to the cell surface by a GPI linkage. FOLR1 can be detected in kidney proximal tubules. It is critically required during early embryogenesis as shown in knockout mice which die in utero with gross morphological defects. FOLR1 binds to folate and reduced folic acid derivatives and mediates delivery of 5-methyltetrahydrofolate and folate analogs into the interior of cells. It Has high affinity for folate and folic acid analogs at neutral pH. Exposure to slightly acidic pH after receptor endocytosis triggers a conformation change that strongly reduces its affinity for folates and mediates their release. Required for normal embryonic development and normal cell proliferation. Required for renal folate reabsorption.

Product Specifications

Gene Name

Folr1

Gene ID

14275

UniProt

P35846

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

TRARTELLNVCMDAKHHKEKPGPEDNLHDQCSPWKTNSCCSTNTSQEAHKDISYLYRFNWNHCGTMTSECKRHFIQDTCLYECSPNLGPWIQQVDQSWRKERILDVPLCKEDCQQWWEDCQSSFTCKSNWHKGWNWSSGHNECPVGASCHPFTFYFPTSAALCEEIWSHSYKLSNYSRGSGRCIQMWFDPAQGNPNEEVARFYAEAMSVDHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

TMEM79 Protein Lysate (Mouse) with C-HA Tag
47093034 100 µg

TMEM79 Protein Lysate (Mouse) with C-HA Tag

Ask
View Details
Ferritin Antigen
MBS8506720-01 0.1 mg

Ferritin Antigen

Ask
View Details
Ferritin Antigen
MBS8506720-02 5x 0.1 mg

Ferritin Antigen

Ask
View Details
Recombinant Human SNRPC Protein, His, Insect-2ug
QP13544-HIS-2ug 2ug

Recombinant Human SNRPC Protein, His, Insect-2ug

Ask
View Details
PTK7 antibody
10R-2220 100 ul

PTK7 antibody

Ask
View Details
Embedding Cassettes (2-grid)
EF-2 250 PCS/Bag - 2000 PCS/CTN

Embedding Cassettes (2-grid)

Ask
View Details