Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human L-Selectin/CD62L (C-6His)

Source: Human Cells. MW :34kD. Recombinant Human L-selectin /sell is produced by our Mammalian expression system and the target gene encoding Trp39-Asn332 is expressed with a 6His tag at the C-terminus. SELL contains one C-type lectin domain, one EGF-like domain and two Sushi (CCP/SCR) domains. SELL is expressed in B-cell lines and T-lymphocytes. SELL functions as a cell surface adhesion protein and mediates the adherence of lymphocytes to endothelial cells of high endothelial venules in peripheral lymph nodes. In addition, SELL also promotes initial tethering and rolling of leukocytes in endothelia.

Product Specifications

Gene Name

SELL

Gene ID

6402

UniProt

P14151

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, 2mM CaCl2, 2mM MgCl2, pH 7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

WTYHYSEKPMNWQRARRFCRDNYTDLVAIQNKAEIEYLEKTLPFSRSYYWIGIRKIGGIWTWVGTNKSLTEEAENWGDGEPNNKKNKEDCVEIYIKRNKDAGKWNDDACHKLKAALCYTASCQPWSCSGHGECVEIINNYTCNCDVGYYGPQCQFVIQCEPLEAPELGTMDCTHPLGNFSFSSQCAFSCSEGTNLTGIEETTCGPFGNWSSPEPTCQVIQCEPLSAPDLGIMNCSHPLASFSFTSACTFICSEGTELIGKKKTICESSGIWSNPSPICQKLDKSFSMIKEGDYNVDHHHHHH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4-(Diethylamino)benzophenone
TRC-B415708-500MG 500 mg

4-(Diethylamino)benzophenone

Sign In for Pricing
View Details
POMP Antibody
KC-40917-01 50 μL

POMP Antibody

Sign In for Pricing
View Details
POMP Antibody
KC-40917-02 100 µL

POMP Antibody

Sign In for Pricing
View Details
POMP Antibody
KC-40917-03 1 mL

POMP Antibody

Sign In for Pricing
View Details
Trichosanthes kirilowii Gel -TKA- Immobilized Lectin
A-5601-2 2 mL

Trichosanthes kirilowii Gel -TKA- Immobilized Lectin

Sign In for Pricing
View Details
Phospho-Chk1 (S345) Recombinant Rabbit Monoclonal Antibody [PS01-17]
HA721189 100 µL

Phospho-Chk1 (S345) Recombinant Rabbit Monoclonal Antibody [PS01-17]

Sign In for Pricing
View Details