Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human L-Selectin/CD62L (C-6His)

Source: Human Cells. MW :34kD. Recombinant Human L-selectin /sell is produced by our Mammalian expression system and the target gene encoding Trp39-Asn332 is expressed with a 6His tag at the C-terminus. SELL contains one C-type lectin domain, one EGF-like domain and two Sushi (CCP/SCR) domains. SELL is expressed in B-cell lines and T-lymphocytes. SELL functions as a cell surface adhesion protein and mediates the adherence of lymphocytes to endothelial cells of high endothelial venules in peripheral lymph nodes. In addition, SELL also promotes initial tethering and rolling of leukocytes in endothelia.

Product Specifications

Gene Name

SELL

Gene ID

6402

UniProt

P14151

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, 2mM CaCl2, 2mM MgCl2, pH 7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

WTYHYSEKPMNWQRARRFCRDNYTDLVAIQNKAEIEYLEKTLPFSRSYYWIGIRKIGGIWTWVGTNKSLTEEAENWGDGEPNNKKNKEDCVEIYIKRNKDAGKWNDDACHKLKAALCYTASCQPWSCSGHGECVEIINNYTCNCDVGYYGPQCQFVIQCEPLEAPELGTMDCTHPLGNFSFSSQCAFSCSEGTNLTGIEETTCGPFGNWSSPEPTCQVIQCEPLSAPDLGIMNCSHPLASFSFTSACTFICSEGTELIGKKKTICESSGIWSNPSPICQKLDKSFSMIKEGDYNVDHHHHHH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DNAH14 Human Gene Knockout Kit (CRISPR)
KN421602 1 Kit

DNAH14 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Uncoated Human CASP3 (Caspase 3) ELISA Kit
E-UNEL-H0290-01 5x 96 Tests

Uncoated Human CASP3 (Caspase 3) ELISA Kit

Sign In for Pricing
View Details
Uncoated Human CASP3 (Caspase 3) ELISA Kit
E-UNEL-H0290-02 15x 96 Tests

Uncoated Human CASP3 (Caspase 3) ELISA Kit

Sign In for Pricing
View Details
BRSK2 (NM_003957) Human Over-expression Lysate
LC401301 20 µg

BRSK2 (NM_003957) Human Over-expression Lysate

Sign In for Pricing
View Details
Accuris High Fidelity Master Mix, 500 rxns
PR1001-HF-500 1 Each

Accuris High Fidelity Master Mix, 500 rxns

Sign In for Pricing
View Details
BEGAIN Mouse Monoclonal Antibody [Clone ID: OTI4C9]
CF810834 100 µg

BEGAIN Mouse Monoclonal Antibody [Clone ID: OTI4C9]

Sign In for Pricing
View Details