Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Parathyroid Hormone/PTH (N-8His)

Source: Human Cells. MW :10.5kD. Recombinant Human Parathyroid Hormone is produced by our Mammalian expression system and the target gene encoding Ser32-Gln115 is expressed with a 8His tag at the N-terminus. Parathyroid hormone (PTH) is a critical hormone in the regulation of Ca++ homeostasis. Parathyroid hormone is the most important endocrine regulator of calcium and phosphorus concentration in extracellular fluid. This hormone is secreted from cells of the parathyroid glands and finds its major target cells in bone and kidney. Another hormone, parathyroid hormone-related protein, binds to the same receptor as parathyroid hormone and has major effects on development. Like most other protein hormones, parathyroid hormone is synthesized as a preprohormone. After intracellular processing, the mature hormone is packaged with in the Golgi into secretory vesicles, the secreted into blood by exocytosis. In renal epithelium, PTH promotes conversion of Vitamin D to its active form, lowers Ca++ excretion and increases phosphate excretion. PTH also increases hematopoietic stem cell proliferation and mobilization and induces arterial vasodilation by regulating Ca++ influx in PTH1R-expressing arterial smooth muscle.

Product Specifications

Gene Name

PTH

Gene ID

5741

UniProt

P01270

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

HHHHHHHHSVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAKSQ

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Mouse Monoclonal B7-H6 Antibody (1002910) [mFluor Violet 450 SE]
FAB10162MFV450 0.1 mL

Mouse Monoclonal B7-H6 Antibody (1002910) [mFluor Violet 450 SE]

Ask
View Details
Label Roll, Cryo, Direct Thermal, 51x6mm
LTC-51X6W 1000/Roll

Label Roll, Cryo, Direct Thermal, 51x6mm

Ask
View Details
Lentiviral human NT5C3A sgRNA gene knockout kit - Lentiviral human NT5C3A sgRNA gene knockout kit (100)
GTR15375892 1 Vial

Lentiviral human NT5C3A sgRNA gene knockout kit - Lentiviral human NT5C3A sgRNA gene knockout kit (100)

Ask
View Details
SNX11 AAV Vector (Mouse) (CMV)
45021104 1 µg

SNX11 AAV Vector (Mouse) (CMV)

Ask
View Details
Lentiviral human ZEB1 shRNA (UAS) - Lentiviral human ZEB1 shRNA (UAS, iRFP) plasmid
GTR15091180 1 Vial

Lentiviral human ZEB1 shRNA (UAS) - Lentiviral human ZEB1 shRNA (UAS, iRFP) plasmid

Ask
View Details
TXNIP (Thioredoxin-Interacting Protein)
494946 100 µL

TXNIP (Thioredoxin-Interacting Protein)

Ask
View Details