Recombinant Human Neurotrimin/NTRI (C-6His)

Source: Human Cells. MW :32.3kD. Recombinant Human Neurotrimin is produced by our Mammalian expression system and the target gene encoding Gly34-Leu316 is expressed with a 6His tag at the C-terminus. Neurotrimin localizes to the cell membrane and contains three Ig-like C2-type (immunoglobulin-like) domains. Neurotrimin acts as a glycosylphosphatidylinositol (GPI) -anchored neural cell adhesion molecule. Neurotrimin may promote neurite outgrowth and adhesion via homophilic and heterophilic interactions.

Product Specifications

Gene Name

NTM

Gene ID

50863

UniProt

Q9P121

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

GDATFPKAMDNVTVRQGESATLRCTIDNRVTRVAWLNRSTILYAGNDKWCLDPRVVLLSNTQTQYSIEIQNVDVYDEGPYTCSVQTDNHPKTSRVHLIVQVSPKIVEISSDISINEGNNISLTCIATGRPEPTVTWRHISPKAVGFVSEDEYLEIQGITREQSGDYECSASNDVAAPVVRRVKVTVNYPPYISEAKGTGVPVGQKGTLQCEASAVPSAEFQWYKDDKRLIEGKKGVKVENRPFLSKLIFFNVSEHDYGNYTCVASNKLGHTNASIMLFGETVLVDHHHHHH