Recombinant Human NKG2-A/NKG2-B Type II Integral Membrane Protein (N-8His)
Source: Human cells. MW :16.5kD. Recombinant Human NKG2-A/NKG2-B Type II Integral Membrane Protein is produced by our Mammalian expression system and the target gene encoding Arg100-Leu233 is expressed with a 8His tag at the N-terminus. NKG2-A/NKG2-B Type II Integral Membrane Protein contains 1 C-type lectin domain and belongs to the killer cell lectin-like receptor family. The killer cell lectin-like receptor family is a group of transmembrane proteins preferentially expressed in NK cells. Members of this proteins is characterized by the type II membrane orientation and the presence of a C-type lectin domain. NKG2 is expressed only in NK-cells, but not in T-cells or B-cells. It has been shown that NKG2 represents a family of related cDNA clones, designated NKG2A, NKG2B, NKG2C, and NKG2D, which encode type 2 integral membrane proteins (extracellular C-terminus) containing a C-type lectin domain. NKG2 plays a role as a receptor for the recognition of MHC class I HLA-E molecules by NK cells and some cytotoxic T-cells. NKG2A and NKG2B have been given the designation CD159a in the nomenclature of CD antigens.
Product Specifications
Gene Name
KLRC1
Gene ID
3821
UniProt
P26715
Components
Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.
Shipping Conditions
The product is shipped at ambient temperature.
Storage Conditions
Applications Notes
Amino Acids
HHHHHHHHRHNNSSLNTRTQKARHCGHCPEEWITYSNSCYYIGKERRTWEESLLACTSKNSSLLSIDNEEEMKFLSIISPSSWIGVFRNSSHHPWVTMNGLAFKHEIKDSDNAELNCAVLQVNRLKSAQCGSSIIYHCKHKL
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items