Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human NKG2-A/NKG2-B Type II Integral Membrane Protein (N-8His)

Source: Human cells. MW :16.5kD. Recombinant Human NKG2-A/NKG2-B Type II Integral Membrane Protein is produced by our Mammalian expression system and the target gene encoding Arg100-Leu233 is expressed with a 8His tag at the N-terminus. NKG2-A/NKG2-B Type II Integral Membrane Protein contains 1 C-type lectin domain and belongs to the killer cell lectin-like receptor family. The killer cell lectin-like receptor family is a group of transmembrane proteins preferentially expressed in NK cells. Members of this proteins is characterized by the type II membrane orientation and the presence of a C-type lectin domain. NKG2 is expressed only in NK-cells, but not in T-cells or B-cells. It has been shown that NKG2 represents a family of related cDNA clones, designated NKG2A, NKG2B, NKG2C, and NKG2D, which encode type 2 integral membrane proteins (extracellular C-terminus) containing a C-type lectin domain. NKG2 plays a role as a receptor for the recognition of MHC class I HLA-E molecules by NK cells and some cytotoxic T-cells. NKG2A and NKG2B have been given the designation CD159a in the nomenclature of CD antigens.

Product Specifications

Gene Name

KLRC1

Gene ID

3821

UniProt

P26715

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

HHHHHHHHRHNNSSLNTRTQKARHCGHCPEEWITYSNSCYYIGKERRTWEESLLACTSKNSSLLSIDNEEEMKFLSIISPSSWIGVFRNSSHHPWVTMNGLAFKHEIKDSDNAELNCAVLQVNRLKSAQCGSSIIYHCKHKL

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Tributyl 3,3',3''-Nitrilotripropionate
TRC-T872905-500MG 500 mg

Tributyl 3,3',3''-Nitrilotripropionate

Ask
View Details
Mouse IFN-beta, Tag Free
HA210789-01 20 µg

Mouse IFN-beta, Tag Free

Ask
View Details
Mouse IFN-beta, Tag Free
HA210789-02 50 µg

Mouse IFN-beta, Tag Free

Ask
View Details
Mouse IFN-beta, Tag Free
HA210789-03 100 µg

Mouse IFN-beta, Tag Free

Ask
View Details
Goat anti-GLUT5/SLC2A5 Antibody
MBS421817-01 0.1 mg

Goat anti-GLUT5/SLC2A5 Antibody

Ask
View Details
Goat anti-GLUT5/SLC2A5 Antibody
MBS421817-02 5x 0.1 mg

Goat anti-GLUT5/SLC2A5 Antibody

Ask
View Details