Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human SOD2/Mn-SOD (C-6His, Human Cells)

Source: Human Cells. MW :23.24kD. Recombinant Human SOD2 is produced by our Mammalian expression system and the target gene encoding Lys25-Lys222 is expressed with a 6His tag at the C-terminus. Superoxide Dismutase (SOD2) belongs to the iron/manganese superoxide dismutase family. SOD2 is a mitochondrial matrix protein that forms a homotetramer and binds one manganese ion per subunit. SOD2 transforms toxic superoxide, a byproduct of the mitochondrial electron transport chain into hydrogen peroxide and diatomic oxygen. It is reported that oxidative stress plays an essential role in the development of breast cancer, while SOD2 is one of the primary enzymes that directly convert potential harmful oxidizing species to harmless metabolites.

Product Specifications

Gene Name

SOD2

Gene ID

6648

UniProt

P04179

Components

Supplied as a 0.2 μm filtered solution of 20mM Tris,150mM NaCl, pH8.0.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

KHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKKVDHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rabbit Monoclonal CD40/TNFRSF5 Antibody (4) [Allophycocyanin]
NBP2-89639APC 0.1 mL

Rabbit Monoclonal CD40/TNFRSF5 Antibody (4) [Allophycocyanin]

Ask
View Details
Vmn2r50 Mouse shRNA Plasmid (Locus ID 434117)
TR518615 1 Kit

Vmn2r50 Mouse shRNA Plasmid (Locus ID 434117)

Ask
View Details
Goat Nucleotide-Binding Oligomerization Domain Containing 2 (NOD2) ELISA Kit
MBS9919322 Inquire

Goat Nucleotide-Binding Oligomerization Domain Containing 2 (NOD2) ELISA Kit

Ask
View Details
Oxidative stress-induced Growth Inhibitor 1 (OSGIN1) Human ELISA Kit
F6244 96 Tests

Oxidative stress-induced Growth Inhibitor 1 (OSGIN1) Human ELISA Kit

Ask
View Details