Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Podoplanin/PDPN/Aggrus (C-Fc)

Source: Human Cells. MW :12.1kD. Recombinant Human Poliovirus Receptor is produced by our Mammalian expression system and the target gene encoding Ala23-Leu131 is expressed with a Fc tag at the C-terminus. Podoplanin is a type-1 transmembrane protein that belongs to Podoplanin family. PDPN expressed in various specialized cell types throughout the body. It highly expressed in placenta, lung, skeletal muscle and brain, weakly expressed in brain, kidney and liver. In placenta, PDPN expressed on the apical plasma membrane of endothelium, in lung, expressed in alveolar epithelium. PDPN physiological function is related to its mucin-type character. PDPN may be involved in cell migration and/or actin cytoskeleton organization. When expressed in keratinocytes, induces changes in cell morphology with transfected cells showing an elongated shape, numerous membrane protrusions, and major reorganization of the actin cytoskeleton, increased motility and decreased cell adhesion. It requires for normal lung cell proliferation and alveolus formation at birth and Induces platelet aggregation. Nevertheless, it doesnâ€TMt have any effect on amino acid transport and the aquaporin-type water channels.

Product Specifications

Gene Name

PDPN

Gene ID

10630

UniProt

Q86YL7

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 .

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

ASTGQPEDDTETTGLEGGVAMPGAEDDVVTPGTSEDRYKSGLTTLVATSVNSVTGIRIEDLPTSESTVHAQEQSPSATASNVATSHSTEKVDGDTQTTVEKDGLSTVTLVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

OR6C76 siRNA (Human)
MBS8236954-01 15 nmol

OR6C76 siRNA (Human)

Ask
View Details
OR6C76 siRNA (Human)
MBS8236954-02 30 nmol

OR6C76 siRNA (Human)

Ask
View Details
OR6C76 siRNA (Human)
MBS8236954-03 5x 30 nmol

OR6C76 siRNA (Human)

Ask
View Details
TRAP220 (H-7) : m-IgG1 BP-HRP Bundle
sc-532398 1 Kit

TRAP220 (H-7) : m-IgG1 BP-HRP Bundle

Ask
View Details
PRR25 (NM_001013638) Human Over-expression Lysate
LY422996 100 µg

PRR25 (NM_001013638) Human Over-expression Lysate

Ask
View Details
Kcnc1 (NM_012856) Rat Untagged Clone
RN212956 10 µg

Kcnc1 (NM_012856) Rat Untagged Clone

Ask
View Details