Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Activin Receptor 1A/Activin RI/ALK-2/ACVR1 (C-6His)

Source: Human Cells. MW :12.6kD. Recombinant Human Activin Receptor IA is produced by our Mammalian expression system and the target gene encoding Met21-Val124 is expressed with a 6His tag at the C-terminus. Activin receptor type-1, also known as Activin receptor type I, Activin receptor-like kinase 2, Serine/threonine-protein kinase receptor R1, TGF-B superfamily receptor type I, ACVRLK2 and ACVR1, is a single-pass type I membrane protein. ACVR1 is expressed in normal parenchymal cells, endothelial cells, fibroblasts and tumor-derived epithelial cells. ACVR1 belongs to the protein kinase superfamily. Activins signal through a heteromeric complex of receptor serine kinases which include at least two type I (I and IB) and two type II (II and IIB) receptors. These receptors are all transmembrane proteins, composed of a ligand-binding extracellular domain with cysteine-rich region, a transmembrane domain, and a cytoplasmic domain with predicted serine/threonine specificity. Type I receptors are essential for signaling; and type II receptors are required for binding ligands and for expression of type I receptors. Type I and II receptors form a stable complex after ligand binding, resulting in phosphorylation of type I receptors by type II receptors. ACVR1 signals a particular transcriptional response in concert with activin type II receptors.

Product Specifications

Gene Name

ACVR1

Gene ID

90

UniProt

Q04771

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MEDEKPKVNPKLYMCVCEGLSCGNEDHCEGQQCFSSLSINDGFHVYQKGCFQVYEQGKMTCKTPPSPGQAVECCQGDWCNRNITAQLPTKGKSFPGTQNFHLEVVDHHHHHH

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

BGB-102 5mg
A21288-5 5 mg

BGB-102 5mg

Ask
View Details
Rat Samd12 Pre-designed siRNA Set B
SI212388B 1 Each

Rat Samd12 Pre-designed siRNA Set B

Ask
View Details
ANO6
555149-01 50 µg

ANO6

Ask
View Details
ANO6
555149-02 100 µg

ANO6

Ask
View Details
Nosip Mouse Gene Knockout Kit (CRISPR)
KN511122 1 Kit

Nosip Mouse Gene Knockout Kit (CRISPR)

Ask
View Details
Mouse CD55/DAF Recombinant Protein
PROTQ61475-250ug 250 µg

Mouse CD55/DAF Recombinant Protein

Ask
View Details