Recombinant Human Activin Receptor 1A/Activin RI/ALK-2/ACVR1 (C-6His)
Source: Human Cells. MW :12.6kD. Recombinant Human Activin Receptor IA is produced by our Mammalian expression system and the target gene encoding Met21-Val124 is expressed with a 6His tag at the C-terminus. Activin receptor type-1, also known as Activin receptor type I, Activin receptor-like kinase 2, Serine/threonine-protein kinase receptor R1, TGF-B superfamily receptor type I, ACVRLK2 and ACVR1, is a single-pass type I membrane protein. ACVR1 is expressed in normal parenchymal cells, endothelial cells, fibroblasts and tumor-derived epithelial cells. ACVR1 belongs to the protein kinase superfamily. Activins signal through a heteromeric complex of receptor serine kinases which include at least two type I (I and IB) and two type II (II and IIB) receptors. These receptors are all transmembrane proteins, composed of a ligand-binding extracellular domain with cysteine-rich region, a transmembrane domain, and a cytoplasmic domain with predicted serine/threonine specificity. Type I receptors are essential for signaling; and type II receptors are required for binding ligands and for expression of type I receptors. Type I and II receptors form a stable complex after ligand binding, resulting in phosphorylation of type I receptors by type II receptors. ACVR1 signals a particular transcriptional response in concert with activin type II receptors.
Product Specifications
Gene Name
ACVR1
Gene ID
90
UniProt
Q04771
Components
Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.
Shipping Conditions
The product is shipped at ambient temperature.
Storage Conditions
Applications Notes
Amino Acids
MEDEKPKVNPKLYMCVCEGLSCGNEDHCEGQQCFSSLSINDGFHVYQKGCFQVYEQGKMTCKTPPSPGQAVECCQGDWCNRNITAQLPTKGKSFPGTQNFHLEVVDHHHHHH
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items