Recombinant Human Bone Marrow Stromal Antigen 2/BST2/Tetherin/CD317 (C-6His)
Source: Human Cells. MW :13.67kD. Recombinant Human Bone Marrow Stromal Antigen 2 is produced by our Mammalian expression system and the target gene encoding Asn49-Ser161 is expressed with a 6His tag at the C-terminus. Bone Marrow Stromal Antigen 2 (BST2) is a single-pass type II membrane protein that belongs to the tetherin family. BST2 is predominantly expressed in the liver, lung, heart and placenta. BST2 is involved in the sorting of secreted proteins. BST2 is a human cellular protein which inhibits retrovirus infection by preventing the diffusion of virus particles after budding from infected cells. BST2 is initially discovered as an inhibitor to HIV-1 infection in the absence of Vpu, it has also been shown to inhibit the release of other viruses such as retroviruses, filoviruses, arenaviruses, and herpes viruses. BST2 may play a role in B-cell activation in rheumatoid arthritis.
Product Specifications
Gene Name
BST2
Gene ID
684
UniProt
Q10589
Components
Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.
Shipping Conditions
The product is shipped at ambient temperature.
Storage Conditions
Applications Notes
Amino Acids
NSEACRDGLRAVMECRNVTHLLQQELTEAQKGFQDVEAQAATCNHTVMALMASLDAEKAQGQKKVEELEGEITTLNHKLQDASAEVERLRRENQVLSVRIADKKYYPSSQDSSVDHHHHHH
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items