Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Bone Marrow Stromal Antigen 2/BST2/Tetherin/CD317 (C-6His)

Source: Human Cells. MW :13.67kD. Recombinant Human Bone Marrow Stromal Antigen 2 is produced by our Mammalian expression system and the target gene encoding Asn49-Ser161 is expressed with a 6His tag at the C-terminus. Bone Marrow Stromal Antigen 2 (BST2) is a single-pass type II membrane protein that belongs to the tetherin family. BST2 is predominantly expressed in the liver, lung, heart and placenta. BST2 is involved in the sorting of secreted proteins. BST2 is a human cellular protein which inhibits retrovirus infection by preventing the diffusion of virus particles after budding from infected cells. BST2 is initially discovered as an inhibitor to HIV-1 infection in the absence of Vpu, it has also been shown to inhibit the release of other viruses such as retroviruses, filoviruses, arenaviruses, and herpes viruses. BST2 may play a role in B-cell activation in rheumatoid arthritis.

Product Specifications

Gene Name

BST2

Gene ID

684

UniProt

Q10589

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

NSEACRDGLRAVMECRNVTHLLQQELTEAQKGFQDVEAQAATCNHTVMALMASLDAEKAQGQKKVEELEGEITTLNHKLQDASAEVERLRRENQVLSVRIADKKYYPSSQDSSVDHHHHHH

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

MycoHunter Mycoplasma Detection Kit, 100 reactions
Q910 1 Kit

MycoHunter Mycoplasma Detection Kit, 100 reactions

Ask
View Details
Lentiviral mouse Samd4b shRNA (UAS) - Lentiviral mouse Samd4b shRNA (UAS) (25)
GTR15272969 1 Vial

Lentiviral mouse Samd4b shRNA (UAS) - Lentiviral mouse Samd4b shRNA (UAS) (25)

Ask
View Details
ADM discontinued
385461 200 µL

ADM discontinued

Ask
View Details
Glucagon Human Recombinant (Glucagon Human)
PT_40700-01 4 mg

Glucagon Human Recombinant (Glucagon Human)

Ask
View Details
Glucagon Human Recombinant (Glucagon Human)
PT_40700-02 10 mg

Glucagon Human Recombinant (Glucagon Human)

Ask
View Details
Glucagon Human Recombinant (Glucagon Human)
PT_40700-03 50 mg

Glucagon Human Recombinant (Glucagon Human)

Ask
View Details