Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Ephrin-A1/EFNA1/LERK-1 (C-6His)

Source: Human Cells. MW :20.39kD. Recombinant Human Ephrin-A1 is produced by our Mammalian expression system and the target gene encoding Asp19-Ser182 is expressed with a 6His tag at the C-terminus. Ephrin-A1 is a member of the A-type ephrin family of cell surface proteins that function as ligands for the A-type Eph receptor tyrosine kinase family. Ephrin-A1 can be induced by TNF and IL1B. Its expression levels can be down-regulated in primary glioma tissues compared to the normal tissues. The soluble monomeric form is expressed in the glioblastoma multiforme (GBM) and breast cancer cells. Soluble Ephrin-A1 is necessary for the transformation of HeLa and SK-BR3 cells and participates in the relocalization of EPHA2 away from sites of cell-cell contact during transformation. Ephrin-A1 plays an important role in angiogenesis and tumor neovascularization.

Product Specifications

Gene Name

EFNA1

Gene ID

1942

UniProt

P20827

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

DRHTVFWNSSNPKFRNEDYTIHVQLNDYVDIICPHYEDHSVADAAMEQYILYLVEHEEYQLCQPQSKDQVRWQCNRPSAKHGPEKLSEKFQRFTPFTLGKEFKEGHSYYYISKPIHQHEDRCLRLKVTVSGKITHSPQAHVNPQEKRLAADDPEVRVLHSIAHSVDHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Human NCK1 Recombinant Protein
PROTP16333-20ug 20 µg

Human NCK1 Recombinant Protein

Ask
View Details
Ifitm1 Mouse shRNA Plasmid (Locus ID 68713)
TL504198 1 Kit

Ifitm1 Mouse shRNA Plasmid (Locus ID 68713)

Ask
View Details
(Rac) -ZLc-002
HY-124996-01 5 mg

(Rac) -ZLc-002

Ask
View Details
(Rac) -ZLc-002
HY-124996-02 10 mM - 1 mL

(Rac) -ZLc-002

Ask
View Details
(Rac) -ZLc-002
HY-124996-03 10 mg

(Rac) -ZLc-002

Ask
View Details
(Rac) -ZLc-002
HY-124996-04 25 mg

(Rac) -ZLc-002

Ask
View Details