Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Proenkephalin-A (C-6His)

Source: Human Cells. MW :29.2kD. Recombinant Human Proenkephalin-A is produced by our Mammalian expression system and the target gene encoding Glu25-Phe267 is expressed with a 6His tag at the C-terminus. Proenkephalin-A is a secreted protein that belongs to the opioid neuropeptide precursor family. Proenkephalin-A is an endogenous opioid polypeptide hormone which, via proteolyic cleavage, produces the enkephalin peptides [Met]enkephalin, and to a lesser extent, [Leu]enkephalin. Met- and Leu-enkephalins compete with and mimic the effects of opiate drugs. They play a role in a number of physiologic functions, including pain perception and responses to stress. Proenkephalin-A (114-133) and Proenkephalin-A (237-258) increase glutamate release in the striatum. Proenkephalin-A (114-133) decreases GABA concentration in the striatum.

Product Specifications

Gene Name

PENK

Gene ID

5179

UniProt

P01210

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

ECSQDCATCSYRLVRPADINFLACVMECEGKLPSLKIWETCKELLQLSKPELPQDGTSTLRENSKPEESHLLAKRYGGFMKRYGGFMKKMDELYPMEPEEEANGSEILAKRYGGFMKKDAEEDDSLANSSDLLKELLETGDNRERSHHQDGSDNEEEVSKRYGGFMRGLKRSPQLEDEAKELQKRYGGFMRRVGRPEWWMDYQKRYGGFLKRFAEALPSDEEGESYSKEVPEMEKRYGGFMRFVDHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

ANKLE1 Antibody
MBS150337-01 0.1 mg

ANKLE1 Antibody

Ask
View Details
ANKLE1 Antibody
MBS150337-02 5x 0.1 mg

ANKLE1 Antibody

Ask
View Details
Polyclonal Anti- human IL-6 Antibody
GWB-BBP013 0.1 mg

Polyclonal Anti- human IL-6 Antibody

Ask
View Details
Rabbit anti Saccharomyces cerevisiae S-Acetyl Coenzyme A synthetase
MBS573224-01 1 mg

Rabbit anti Saccharomyces cerevisiae S-Acetyl Coenzyme A synthetase

Ask
View Details
Rabbit anti Saccharomyces cerevisiae S-Acetyl Coenzyme A synthetase
MBS573224-02 5x 1 mg

Rabbit anti Saccharomyces cerevisiae S-Acetyl Coenzyme A synthetase

Ask
View Details
Plasmodium sp.
MBS328038-01 0.1 mg

Plasmodium sp.

Ask
View Details