Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human CD99 Antigen-Like Protein 2/CD99L2 (C-6His)

Source: Human Cells. MW :18.4kD. Recombinant Human CD99 Antigen-Like Protein 2 is produced by our Mammalian expression system and the target gene encoding Asp26-Ala188 is expressed with a 6His tag at the C-terminus. CD99 Antigen-Like Protein 2 (CD99L2) belongs to the CD99 family. CD99L2 is a single-pass type I membrane protein and expressed in many tissues, with low expression in thymus. CD99L2 plays a role in a late step of leukocyte extravasation helping cells to overcome the endothelial basement membrane. CD99L2 and CD99 are involved in trans-endothelial migration of neutrophils in vitro and in the recruitment of neutrophils into inflamed peritoneum. A similar protein in mouse functions as an adhesion molecule during leukocyte extravasation. Alternate splicing results in multiple transcript variants.

Product Specifications

Gene Name

CD99L2

Gene ID

83692

UniProt

Q8TCZ2

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

DFDDFNLEDAVKETSSVKQPWDHTTTTTTNRPGTTRAPAKPPGSGLDLADALDDQDDGRRKPGIGGRERWNHVTTTTKRPVTTRAPANTLGNDFDLADALDDRNDRDDGRRKPIAGGGGFSDKDLEDIVGGGEYKPDKGKGDGRYGSNDDPGSGMVAEPGTIAVDHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

RCC1 (Regulator of Chromosome Condensation 1, CHC1, RCC1-I) (Biotin)
MBS6173883-01 0.1 mL

RCC1 (Regulator of Chromosome Condensation 1, CHC1, RCC1-I) (Biotin)

Ask
View Details
RCC1 (Regulator of Chromosome Condensation 1, CHC1, RCC1-I) (Biotin)
MBS6173883-02 5x 0.1 mL

RCC1 (Regulator of Chromosome Condensation 1, CHC1, RCC1-I) (Biotin)

Ask
View Details
Bovine Bone Morphogenetic Protein 1 BMP1 ELISA Kit
BG-BVN10363 1 Each

Bovine Bone Morphogenetic Protein 1 BMP1 ELISA Kit

Ask
View Details
Isatoic Anhydride
TRC-I777600-100G 100 g

Isatoic Anhydride

Ask
View Details
SNAP 25, CT (SNAP25, Synaptosomal-Associated protein 25, SNAP-25, Synaptosomal-Associated 25kD Protein, SUP, Super Protein, SNAP, Synaptosomal-Associated Protein, 25kDa) (FITC) discontinued
S1014-70A-FITC 100 µL

SNAP 25, CT (SNAP25, Synaptosomal-Associated protein 25, SNAP-25, Synaptosomal-Associated 25kD Protein, SUP, Super Protein, SNAP, Synaptosomal-Associated Protein, 25kDa) (FITC) discontinued

Ask
View Details