Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Lymphocyte Antigen 6H/LY6H (C-6His)

Source: Human Cells. MW :10.9kD. Recombinant Human Lymphocyte Antigen 6H is produced by our Mammalian expression system and the target gene encoding Leu26-Gly115 is expressed with a 6His tag at the C-terminus. Lymphocyte Antigen 6H (LY6H) is a novel member of the LY6 family of glycosylphosphatidylinositol-anchored cell surface glycoproteins. LY6H contains one UPAR/Ly6 domain. Human LY6H is synthesized as a 140 amino acid precursor that contains a 25 amino acid signal sequence, 20 amino acid propeptide that is removed in the mature form, and a 90 amino acid mature chain. LY6H is highly expressed in the brain (cerebral cortex, amygdala, hippocampus and subthalamic nucleus) and in acute human leukemic cell line MOLT-3. It is also found in lower levels in testis, pancreas, small intestine and colon. It has been shown that LY6H may play a role in both the central nervous system and the immune system.

Product Specifications

Gene Name

LY6H

Gene ID

4062

UniProt

O94772

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

LWCQDCTLTTNSSHCTPKQCQPSDTVCASVRITDPSSSRKDHSVNKMCASSCDFVKRHFFSDYLMGFINSGILKVDVDCCEKDLCNGAAGLDHHHHHH

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Recombinant Human PKLR CF
8569-PK-050 50 µg

Recombinant Human PKLR CF

Ask
View Details
XMU-MP-1 5mg
A16228-5 5 mg

XMU-MP-1 5mg

Ask
View Details
SuLf2 (NM_001034927) Rat Tagged ORF Clone Lentiviral Particle
RR210063L3V 200 µL

SuLf2 (NM_001034927) Rat Tagged ORF Clone Lentiviral Particle

Ask
View Details
Rabbit Polyclonal DDRGK1 Antibody [DyLight 680]
NBP2-99194FR 0.1 mL

Rabbit Polyclonal DDRGK1 Antibody [DyLight 680]

Ask
View Details