Recombinant Human Lymphocyte Antigen 6H/LY6H (C-6His)
Source: Human Cells. MW :10.9kD. Recombinant Human Lymphocyte Antigen 6H is produced by our Mammalian expression system and the target gene encoding Leu26-Gly115 is expressed with a 6His tag at the C-terminus. Lymphocyte Antigen 6H (LY6H) is a novel member of the LY6 family of glycosylphosphatidylinositol-anchored cell surface glycoproteins. LY6H contains one UPAR/Ly6 domain. Human LY6H is synthesized as a 140 amino acid precursor that contains a 25 amino acid signal sequence, 20 amino acid propeptide that is removed in the mature form, and a 90 amino acid mature chain. LY6H is highly expressed in the brain (cerebral cortex, amygdala, hippocampus and subthalamic nucleus) and in acute human leukemic cell line MOLT-3. It is also found in lower levels in testis, pancreas, small intestine and colon. It has been shown that LY6H may play a role in both the central nervous system and the immune system.
Product Specifications
Gene Name
LY6H
Gene ID
4062
UniProt
O94772
Components
Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.
Shipping Conditions
The product is shipped at ambient temperature.
Storage Conditions
Applications Notes
Amino Acids
LWCQDCTLTTNSSHCTPKQCQPSDTVCASVRITDPSSSRKDHSVNKMCASSCDFVKRHFFSDYLMGFINSGILKVDVDCCEKDLCNGAAGLDHHHHHH
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items