Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Natural Killer Cells Antigen CD94/CD94 (N-6His)

Source: Human Cells. MW :17.7kD. Recombinant Human Natural Killer Cells Antigen CD94 is produced by our Mammalian expression system and the target gene encoding Ser34-Ile179 is expressed with a 6His tag at the N-terminus. CD94 (Cluster of Differentiation 94), also known as killer cell lectin-like receptor subfamily D member 1 (KLRD1), is expressed on the surface of natural killer cells in the innate immune system. CD94 Plays a role as a receptor for the recognition of MHC class I HLA-E molecules by NK cells and some cytotoxic T-cells. CD94 Can form disulfide-bonded heterodimer with NKG2 family members. The CD94/NKG2 complex, on the surface of natural killer cells interacts with Human Leukocyte Antigen (HLA) -E on target cells. Natural killer (NK) cells are a distinct lineage of lymphocytes that mediate cytotoxic activity and secrete cytokines upon immune stimulation. Several genes of the C-type lectin superfamily, including members of the NKG2 family, are expressed by NK cells and may be involved in the regulation of NK cell function. KLRD1 (CD94) is an antigen preferentially expressed on NK cells and is classified as a type II membrane protein because it has an external C terminus.

Product Specifications

Gene Name

KLRD1

Gene ID

3824

UniProt

Q13241

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

HHHHHHSFTKLSIEPAFTPGPNIELQKDSDCCSCQEKWVGYRCNCYFISSEQKTWNESRHLCASQKSSLLQLQNTDELDFMSSSQQFYWIGLSYSEEHTAWLWENGSALSQYLFPSFETFNTKNCIAYNPNGNALDESCEDKNRYICKQQLI
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

TBX6 ORF Vector (Human) (pORF)
46311011 1.0 µg DNA

TBX6 ORF Vector (Human) (pORF)

Ask
View Details
Mouse Mandibular Osteocyte Medium
ARM0586 500 mL

Mouse Mandibular Osteocyte Medium

Ask
View Details
Human DNA Repair Protein RAD50 (RAD50) Antibody Pair Kit (with Standard)
MBS2104132-01 5x 96 Tests

Human DNA Repair Protein RAD50 (RAD50) Antibody Pair Kit (with Standard)

Ask
View Details
Human DNA Repair Protein RAD50 (RAD50) Antibody Pair Kit (with Standard)
MBS2104132-02 5x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1,5x 96 Tests)

Human DNA Repair Protein RAD50 (RAD50) Antibody Pair Kit (with Standard)

Ask
View Details
Human DNA Repair Protein RAD50 (RAD50) Antibody Pair Kit (with Standard)
MBS2104132-03 10x 96 Tests

Human DNA Repair Protein RAD50 (RAD50) Antibody Pair Kit (with Standard)

Ask
View Details
Human DNA Repair Protein RAD50 (RAD50) Antibody Pair Kit (with Standard)
MBS2104132-04 10x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1, 10x 96 Tests)

Human DNA Repair Protein RAD50 (RAD50) Antibody Pair Kit (with Standard)

Ask
View Details