Recombinant Human Activin Receptor 1B/Activin RIB/ALK-4/ACVR1B (C-6His)
Source: Human Cells. MW :12.46kD. Recombinant Human Activin Receptor IB is produced by our Mammalian expression system and the target gene encoding Ser24-Glu126 is expressed with a 6His tag at the C-terminus. Activin Receptor Type-1B (ACVR1B) is a single-pass type I membrane protein that belongs to the protein kinase superfamily. ACVR1B contains one GS domain and one protein kinase domain and is expressed in many tissues, most strongly in kidney, pancreas, brain, lung, and liver. ACVR1B acts as a transducer of activin or activin like ligands signals. Activin binds to either ACVR2A or ACVR2B and then forms a complex with ACVR1B, ACVR2A or ACVR2B activating ACVR1B through phosphorylation of its regulatory GS domain. They go on to recruit the R-SMADs, SMAD2 and SMAD3. ACVR1B also transducers signals of nodal, GDF-1, and Vg1. Mutations in ACVR1B are associated with pituitary tumors.
Product Specifications
Gene Name
ACVR1B
Gene ID
91
UniProt
P36896
Components
Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.
Shipping Conditions
The product is shipped at ambient temperature.
Storage Conditions
Applications Notes
Amino Acids
SGPRGVQALLCACTSCLQANYTCETDGACMVSIFNLDGMEHHVRTCIPKVELVPAGKPFYCLSSEDLRNTHCCYTDYCNRIDLRVPSGHLKEPEHPSMWGPVEVDHHHHHH
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items