Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transforming Growth Factor beta-1/TGFB1

Source: Human Cells. MW :12.8kD. Recombinant Human Transforming Growth Factor beta 1 is produced by our Mammalian expression system and the target gene encoding Ala279-Ser390 is expressed. Transforming Growth Factor beta-1 (TGF beta-1) is a secreted protein which belongs to the TGF- beta family. TGF beta-1 is abundantly expressed in bone, articular cartilage and chondrocytes and is increased in osteoarthritis (OA) . TGF beta-1 performs many cellular functions, including the control of cell growth, cell proliferation, cell differentiation and apoptosis. The precursor is cleaved into a latency-associated peptide (LAP) and a mature TGF beta-1 peptide. TGF beta-1 may also form heterodimers with other TGF beta family members. It has been found that TGF beta-1 is frequently upregulated in tumor cells. Mutations in this gene results in Camurati-Engelmann disease.

Product Specifications

Gene Name

TGFB1

Gene ID

7040

UniProt

P01137

Components

Lyophilized from a 0.2 μm filtered solution of 50mM Glycine 50mM NaCl pH4.0.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

MMAB siRNA (Human)
CRJ7201-01 15 nmol

MMAB siRNA (Human)

Ask
View Details
MMAB siRNA (Human)
CRJ7201-02 30 nmol

MMAB siRNA (Human)

Ask
View Details
Rat Efcab5 Pre-designed siRNA Set A
SI204247A 1 Each

Rat Efcab5 Pre-designed siRNA Set A

Ask
View Details
IL5RA Protein (C-His, Mouse)
P525990 100 µg

IL5RA Protein (C-His, Mouse)

Ask
View Details
TYW3 Rabbit Polyclonal Antibody
TA340300 100 µL

TYW3 Rabbit Polyclonal Antibody

Ask
View Details
HOXB1 (Homeobox Protein Hox-B1, Homeobox Protein Hox-2I, HOX2I, MGC116843, MGC116844, MGC116845)
MBS641494-01 0.1 mg

HOXB1 (Homeobox Protein Hox-B1, Homeobox Protein Hox-2I, HOX2I, MGC116843, MGC116844, MGC116845)

Ask
View Details