Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transforming Growth Factor beta-1/TGFB1

Source: Human Cells. MW :12.8kD. Recombinant Human Transforming Growth Factor beta 1 is produced by our Mammalian expression system and the target gene encoding Ala279-Ser390 is expressed. Transforming Growth Factor beta-1 (TGF beta-1) is a secreted protein which belongs to the TGF- beta family. TGF beta-1 is abundantly expressed in bone, articular cartilage and chondrocytes and is increased in osteoarthritis (OA) . TGF beta-1 performs many cellular functions, including the control of cell growth, cell proliferation, cell differentiation and apoptosis. The precursor is cleaved into a latency-associated peptide (LAP) and a mature TGF beta-1 peptide. TGF beta-1 may also form heterodimers with other TGF beta family members. It has been found that TGF beta-1 is frequently upregulated in tumor cells. Mutations in this gene results in Camurati-Engelmann disease.

Product Specifications

Gene Name

TGFB1

Gene ID

7040

UniProt

P01137

Components

Lyophilized from a 0.2 μm filtered solution of 50mM Glycine 50mM NaCl pH4.0.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Ccni (NM_001105998) Rat Tagged Lenti ORF Clone
RR204784L4 10 µg

Ccni (NM_001105998) Rat Tagged Lenti ORF Clone

Ask
View Details
Rabbit Adrenocorticotropic Hormone (ACTH) ValidElisa Kit
EK347229 96 Well

Rabbit Adrenocorticotropic Hormone (ACTH) ValidElisa Kit

Ask
View Details
Rabbit anti-Escherichia coli O9:H4 (strain HS) CMOB Polyclonal Antibody
MBS7169809 Inquire

Rabbit anti-Escherichia coli O9:H4 (strain HS) CMOB Polyclonal Antibody

Ask
View Details