Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transforming Growth Factor beta-1/TGFB1

Source: Human Cells. MW :12.8kD. Recombinant Human Transforming Growth Factor beta 1 is produced by our Mammalian expression system and the target gene encoding Ala279-Ser390 is expressed. Transforming Growth Factor beta-1 (TGF beta-1) is a secreted protein which belongs to the TGF- beta family. TGF beta-1 is abundantly expressed in bone, articular cartilage and chondrocytes and is increased in osteoarthritis (OA) . TGF beta-1 performs many cellular functions, including the control of cell growth, cell proliferation, cell differentiation and apoptosis. The precursor is cleaved into a latency-associated peptide (LAP) and a mature TGF beta-1 peptide. TGF beta-1 may also form heterodimers with other TGF beta family members. It has been found that TGF beta-1 is frequently upregulated in tumor cells. Mutations in this gene results in Camurati-Engelmann disease.

Product Specifications

Gene Name

TGFB1

Gene ID

7040

UniProt

P01137

Components

Lyophilized from a 0.2 μm filtered solution of 50mM Glycine 50mM NaCl pH4.0.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pigeon Protein Tyrosine Phosphatase Receptor Type H ELISA Kit
MBS061001 Inquire

Pigeon Protein Tyrosine Phosphatase Receptor Type H ELISA Kit

Sign In for Pricing
View Details
Dpt (NM_001105965) Rat Tagged Lenti ORF Clone
RR206272L3 10 µg

Dpt (NM_001105965) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
OriCell™ Complete Medium For Canine Bone Marrow Mesenchymal Stem Cells (Without EXO)
CAXMX-90012 500 mL

OriCell™ Complete Medium For Canine Bone Marrow Mesenchymal Stem Cells (Without EXO)

Sign In for Pricing
View Details
CE027 rabbit pAb
E28PN3537 100 µL

CE027 rabbit pAb

Sign In for Pricing
View Details
UQCRQ 3'UTR Lenti-reporter-Luc Vector
49244081 1.0 µg

UQCRQ 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
EGFR Peptide (human, mouse) TFA
orb1980110-01 100 mg

EGFR Peptide (human, mouse) TFA

Sign In for Pricing
View Details