Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Collectin-11/COLEC11 (C-6His)

Source: Human Cells. MW :27.14kD. Recombinant Human Collectin-11 is produced by our Mammalian expression system and the target gene encoding Gln26-Met271 is expressed with a 6His tag at the C-terminus. Collectin-11 is a secreted protein that belongs to the COLEC10/COLEC11 family. Collectin-11 contains one C-type lectin domain and one collagen-like domain. Collectins play important roles in the innate immune system by binding to carbohydrate antigens on microorganisms, facilitating their recognition and removal. Collectin-11 binds to various sugars including fucose and mannose, but does not bind to glucose, N-acetylglucosamine and N-acetylgalactosamine. It has a higher affinity for fucose compared to mannose. Collectin-11 binds lipopolysaccharides (LPS) . It also involved in fundamental development serving as a guidance cue for neural crest cell migration. Defects in Collectin-11 are the cause of 3MC syndrome type 2 (3MC2) .

Product Specifications

Gene Name

COLEC11

Gene ID

78989

UniProt

Q9BWP8

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

QPAGDDACSVQILVPGLKGDAGEKGDKGAPGRPGRVGPTGEKGDMGDKGQKGSVGRHGKIGPIGSKGEKGDSGDIGPPGPNGEPGLPCECSQLRKAIGEMDNQVSQLTSELKFIKNAVAGVRETESKIYLLVKEEKRYADAQLSCQGRGGTLSMPKDEAANGLMAAYLAQAGLARVFIGINDLEKEGAFVYSDHSPMRTFNKWRSGEPNNAYDEEDCVEMVASGGWNDVACHTTMYFMCEFDKENMVDHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Mouse Cby1/PGEA1 (Protein chibby homolog 1) ELISA Kit
EM6443 96 Tests

Mouse Cby1/PGEA1 (Protein chibby homolog 1) ELISA Kit

Ask
View Details
20ul Filter pipette tips
TF-020-R-SLD 96 / Box - 50 Boxes/Carton

20ul Filter pipette tips

Ask
View Details
Human ESR2 Matched Antibody Pair Set [ABP-S-051713]
ABP-S-051713 5 Plates

Human ESR2 Matched Antibody Pair Set [ABP-S-051713]

Ask
View Details
Lentiviral human GPR52 sgRNA gene knockout kit - Lentiviral human GPR52 sgRNA gene knockout kit (100)
GTR15387313 1 Vial

Lentiviral human GPR52 sgRNA gene knockout kit - Lentiviral human GPR52 sgRNA gene knockout kit (100)

Ask
View Details
Chka Rat shRNA Plasmid (Locus ID 29194)
TF709936 1 Kit

Chka Rat shRNA Plasmid (Locus ID 29194)

Ask
View Details
Exportin T (XPOT) Human shRNA Plasmid Kit (Locus ID 11260)
TL308340 1 Kit

Exportin T (XPOT) Human shRNA Plasmid Kit (Locus ID 11260)

Ask
View Details