Recombinant Human Clusterin-Like Protein 1/CLUL1 (C-6His)

Source: Human Cells. MW :50.06kD. Recombinant Human Clusterin-Like Protein 1 is produced by our Mammalian expression system and the target gene encoding Ala21-Ala442 is expressed with a 6His tag at the C-terminus. Clusterin-Like Protein 1 (CLUL1) is a secreted protein that belongs to the clusterin family. CLUL1 is synthesized as a 466 amino acid precursor that contains a 20 amino acid signal sequence, and a 446 amino acid mature chain. CLUL1 is expressed predominantly by cone photoreceptors of the retina. It has been shown that CLUL1 expression is down-regulated in some forms of retinal disease.

Product Specifications

Gene Name

CLUL1

Gene ID

27098

UniProt

Q15846

Components

Lyophilized from a 0.2 μm filtered solution of 20mM Tris,150mM NaCl, pH8.0.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

APTWKDKTAISENLKSFSEVGEIDADEEVKKALTGIKQMKIMMERKEKEHTNLMSTLKKCREEKQEALKLLNEVQEHLEEEERLCRESLADSWGECRSCLENNCMRIYTTCQPSWSSVKNKIERFFRKIYQFLFPFHEDNEKDLPISEKLIEEDAQLTQMEDVFSQLTVDVNSLFNRSFNVFRQMQQEFDQTFQSHFISDTDLTEPYFFPAFSKEPMTKADLEQCWDIPNFFQLFCNFSVSIYESVSETITKMLKAIEDLPKQDKAPDHGGLISKMLPGQDRGLCGELDQNLSRCFKFHEKCQKCQAHLSEDCPDVPALHTELDEAIRLVNVSNQQYGQILQMTRKHLEDTAYLVEKMRGQFGWVSELANQAPETEIIFNSIQVVPRIHEGNISKQDETMMTDLSILPSSNFTLKIPLEESAVDHHHHHH