Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Serpin A10/ZPI (C-6His)

Source: Human Cells. MW :49.5kD. Recombinant Human Serpin A10 is produced by our Mammalian expression system and the target gene encoding Leu22-Leu444 is expressed with a 6His tag at the C-terminus. Serpin A10 is a secreted protein that belongs to the serpin family. It is predominantly expressed in the liver and secreted in the plasma. Its phosphorylation sites are present in the extracelllular medium. It inhibits factors Xa and XIa of the coagulation cascade in the presence of protein Z, calcium, and phospholipid. Mutations in SERPINA10 are associated with venous thrombosis.

Product Specifications

Gene Name

SERPINA10

Gene ID

51156

UniProt

Q9UK55

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,1mM GaCl2, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

LAPSPQSPETPAPQNQTSRVVQAPKEEEEDEQEASEEKASEEEKAWLMASRQQLAKETSNFGFSLLRKISMRHDGNMVFSPFGMSLAMTGLMLGATGPTETQIKRGLHLQALKPTKPGLLPSLFKGLRETLSRNLELGLTQGSFAFIHKDFDVKETFFNLSKRYFDTECVPMNFRNASQAKRLMNHYINKETRGKIPKLFDEINPETKLILVDYILFKGKWLTPFDPVFTEVDTFHLDKYKTIKVPMMYGAGKFASTFDKNFRCHVLKLPYQGNATMLVVLMEKMGDHLALEDYLTTDLVETWLRNMKTRNMEVFFPKFKLDQKYEMHELLRQMGIRRIFSPFADLSELSATGRNLQVSRVLQRTVIEVDERGTEAVAGILSEITAYSMPPVIKVDRPFHFMIYEETSGMLLFLGRVVNPTLLLDHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

(S)-Naproxen Acyl-Beta-D-glucuronide
TRC-N377530-1MG 1 mg

(S)-Naproxen Acyl-Beta-D-glucuronide

Ask
View Details
N-Term Biotin label (latent wild type)
MBS480714-01 0.5 mg

N-Term Biotin label (latent wild type)

Ask
View Details
N-Term Biotin label (latent wild type)
MBS480714-02 5x 0.5 mg

N-Term Biotin label (latent wild type)

Ask
View Details
Phospho-AHR/AHRR (S36) Antibody
MBS7118158-01 0.05 mg

Phospho-AHR/AHRR (S36) Antibody

Ask
View Details
Phospho-AHR/AHRR (S36) Antibody
MBS7118158-02 0.1 mg

Phospho-AHR/AHRR (S36) Antibody

Ask
View Details
Phospho-AHR/AHRR (S36) Antibody
MBS7118158-03 5x 0.1 mg

Phospho-AHR/AHRR (S36) Antibody

Ask
View Details